Le blog > ParisTech Business Angels & Startups

 
28
Juil
'20

Lettre d'information Externe Juillet 2020 N°117

 

Lettre d'information externe Juillet 2020 - N ° 117

 

EDITO

Chers adhérentes et adhérents, chers lecteurs,  

L’Assemblée Générale de début Juin a été l’occasion de faire le bilan de notre activité en 2019.

C’était aussi la première AG que j’ai présidée depuis mon élection en juin 2019.
Notre association s’est classée à nouveau première en Ile-de-France et troisième au niveau national. En cumulé sur quatre ans, nous sommes très largement en tête avec 11M€ financés. Vous trouverez les principaux chiffres dans cette newsletter.
Nous préparons également notre rapport annuel qui sera disponible en Juillet.  Reprenant l’essentiel de ce qui a été présenté lors de l’AG, il constitue un excellent outil de présentation de BADGE.
Au-delà de ces bons résultats, de la croissance forte du nombre de nos membres depuis le début d’année, je me réjouis du dynamisme de notre association dont témoigne l’implication de nouveaux membres s’investissant dans le Sourcing de nouveaux projets, dans le Comité de Validation et dans l’instruction de projets.
Nos réunions s’arrêtent pendant l’été et reprendront avec un Comité de Sélection le 8 septembre 2020 dans les locaux de Bpifrance si la pandémie de Covid-19 demeure sous contrôle. D’ici là plusieurs dossiers sont en clôture de leur levée de fonds.

Je vous souhaite de passer de bonnes vacances. Amicalement.  

Jacques Tamisier Président des Business Angels des Grandes Écoles

 

Compte-rendu de l'Assemblée Générale Ordinaire 2020

Mercredi 10 juin 2020 s’est tenue l’assemblée générale ordinaire de l'association dans des conditions particulières et inédites.  En raison de la situation sanitaire liée à la Covid-19, cette AG a été organisée en visio-conférence.
Jacques Tamisier, Président de BADGE, a dressé le bilan de l’activité de 2019 devant les 56 adhérents connectés à distance.

Membre de France Angels, fédération nationale des Business Angels, l’association BADGE (Les Business Angels des Grandes Écoles) créée fin 2004, demeure en 2019 le premier réseau d’Ile-de-France par son nombre de membres (254) et les montants investis (2,5 M€).
Après un fléchissement en 2018, le nombre d’adhérents a augmenté en 2019, dépassant le seuil des 250 atteint en 2017. Le réseau BADGE accueille toute personne ayant l’expérience professionnelle et la capacité financière requise pour devenir Business Angel, ainsi que tout projet innovant, sans obligation pour le porteur de projet d’être ancien élève d’une Grande Ecole.
Jacques Tamisier a rappelé l’importance du « Sourcing » assuré par Paul Bruma et les 15 adhérents « Dénicheurs de pépites ». Cette équipe avec un travail de fond, a assisté à une soixantaine de manifestations, pour repérer, rencontrer 1 000 entreprises et porteurs de projets, et inciter les meilleurs à déposer leur projet sur la plateforme BADGE.
Jacques Tamisier a insisté sur l’importance du travail de tri et de sélection animé par François Levé, Vice-Président en charge des Comités de Validation et de Sélection avec : 247 projets reçus et 126 projets étudiés en 32 sessions de Comité de validation. 50 dossiers retenus pour le Comité de Sélection auront permis à 29 start-up de présenter leur projet devant les investisseurs BADGE au cours de 9 réunions mensuelles animées par Michel Huet, Secrétaire Général en charge de l’instruction des dossiers.
En 2019, nos adhérents ont participé à 25 levées de fonds pour 2,5 M€. Le montant moyen par investisseur (23,3k€) hors SIBA est dans la moyenne des dix dernières années.
Sur 25 levées de fonds, les secteurs d’activité dans lesquels nous avons investi sont : Santé et Biotech (35%), Industrie (35%), Numérique (20%), Développement durable et Services (10%).
Depuis la création de l’association en 2004, après 2650 projets étudiés et 550 retenus, 400 Business Angels des Grandes Ecoles ont ainsi financé 175 entreprises innovantes en apportant 32,7 M€. Ces investissements, par effet de levier sur d'autres sources de financement, ont généré près de 100 M€ d'apport de capitaux dans les entreprises.
Sur les 175 sociétés financées entre 2005 et 2019, 94 sociétés sont toujours en portefeuille.
Isabelle Reulier, Trésorière, a présenté le rapport des comptes de l’exercice clos le 31/12/2019. 
Gilles Drouard et Christian Nguyen-Van-Yen font leur entrée au Conseil d’Administration, élus à l’unanimité en remplacement d’Audra Shallal, non rééligible et Christian Houzé qui n’a pas sollicité le renouvellement de son mandat.
Jacques Tamisier les a chaleureusement remerciés pour leur contribution tout au long des nombreuses années où ils ont siégé au CA.
Jean-François Macquin et Jean-François Desplat ont été renouvelés à l’unanimité.
A l’issue de cette AG, le Conseil d’Administration s’est réuni pour élire le nouveau Bureau dans lequel Philippe Pernot fait son entrée en remplacement de Jean-François Macquin.

Découvrir la nouvelle composition du Conseil d'Administration

La parenthèse des mesures d’urgence sanitaire se refermant progressivement, nous espérons que l’édition 2021 de notre AGO permettra à nouveau aux adhérentes et adhérents de BADGE, de vivre comme par le passé ce grand moment ensemble sur le même site et de partager leurs expériences autour d'un cocktail amical.

 

SIBA BADGE 2017

Jean-François Macquin quitte la présidence de la SIBA BADGE 2017. Patrick Frinault le remplace.

 

Patrick Frinault (Supelec 76) a rejoint BADGE en 2011 souhaitant donner plus de sens aux investissements qu'il réalisait dans de jeunes pousses innovantes, en suivant et en accompagnant ces entreprises. Son parcours d'ingénieur dans l'automatisation de processus industriels l'a amené pendant 20 ans à parcourir les continents. Son parcours est complété par différentes fonctions industrielles et dans les systèmes d'information. 

A la retraite depuis deux ans, Patrick Frinault a retrouvé le temps d'instruire, d'accompagner, d'évaluer des projets, l'occasion de rencontres passionnantes et d'une ouverture constante à de nouvelles idées.

 
 

Après une carrière passionnante et variée chez IBM, Rhône Poulenc devenu Aventis puis Sanofi, dans l’Informatique et la finance, le virus du «small is beautiful» a touché Jean-François Macquin (EMN66). Convaincu que l’innovation, le développement est principalement l’apanage de petites structures très motivées acceptant le risque sans ménager leur peine, il décide de s’investir dans leur soutien à travers BADGE dès 2016.

Très impliqué dans la refonte de notre plateforme informatique (SIG), membre (très) Actif, Jean-François Macquin sera Administrateur, Vice Président en charge de la relation avec les écoles et Président de la SIBA BADGE 2017. Alors qu’il cède la place à Patrick Frinault, nous le remercions pour son investissement personnel et sa légendaire bonne humeur qui nous accompagne à chacune de ses visites. Nous souhaitons la bienvenue à Patrick Frinault, nouveau Président de la SIBA BADGE 2017.

PROCHAINS RENDEZ-VOUS

 

Après quelques mois de réunions en visio-conférence en raison de la Covid-19, et une trêve estivale bienvenue, nous serons heureux de vous retrouver en septembre pour reprendre notre cycle de réunions mensuelles sur nos sites habituels.

>>> PRÉSENTATIONS DE PROJETS

Réunions mensuelles avec présentation de projets innovants en recherche de fonds animés par Michel Huet , Secrétaire Général, chargé de l'Instruction. Réservées à nos adhérents. Non-adhérents, demandez votre invitation.

 

Lundi 21 septembre 2020 à 17h30

Le Centorial - Campus EDHEC Alumni de Paris

18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d'un cocktail. Inscription obligatoire, se munir d'une pièce d'identité.

S'inscrire
 

Mardi 13 octobre 2020 à 17h30

Le Centorial - Campus EDHEC Alumni de Paris

18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d'un cocktail. Inscription obligatoire, se munir d'une pièce d'identité.

S'inscrire

Retrouvez nos prochaines dates de réunion en 2020:

https://business-angels.info/actualites

RESEAU ET PARTENAIRES  

 

Les investissements des Business Angels français connaissent une nette hausse en 2019 : 43 M€ investis dans 422 opérations

LIRE LE COMMUNIQUÉ DE PRESSE

FRANCE ANGELS s’associe aux vœux du Président de la République de reconstruire une économie forte, écologique, souveraine et solidaire. Pour la protection immédiate des TPE et des PME qui seront le moteur de la relance de l’économie du pays à l’issue de la crise sanitaire, FRANCE ANGELS appelle le gouvernement Français à favoriser l’investissement de l’épargne des particuliers dans les fonds propres de ces entreprises.

Cette action est d’autant plus primordiale également pour, d’une part, la sécurisation du remboursement des PGE octroyés (dont rappelons-le l’Etat en est le garant à hauteur de 90%), ainsi que pour accompagner la relance de nos territoires et de nos bassins d’emplois, par l’investissement dans nos entreprises locales, d’autre part.
Ainsi, FRANCE ANGELS – Fédération Nationale des Business Angels - recommande l’adoption d’une série de mesures d’urgence complémentaires, aujourd’hui autorisées par l’encadrement temporaire des aides d’Etat adopté par la Commission européenne pour soutenir l’économie. Ces mesures entreraient en vigueur rapidement pour une période de deux ans.
Cette série de mesures, vous est présentée dans le communiqué de Presse : "Orienter l’épargne des particuliers vers les TPE et PME ! ».

EN SAVOIR +
 
 

Appel à candidature pour la 17ème édition de Graines de Boss

Start-up, porteurs de projet, il est encore temps de rejoindre la 17ème édition de ce concours organisé par Graines de Boss et soutenu par FRANCE ANGELS, la Fédération Nationale des Business Angels. Parrainé par le Ministère de l'Economie et des Finances, avec M6 partenaire média historique qui le lance chaque année dans l’émission Capital, Graines de Boss bénéficie d’une importante notoriété, séduisant chaque année un nombre croissant d’entrepreneurs, de cadres dirigeants et d’investisseurs.

EN SAVOIR + ET CANDIDATER
 

Nos derniers closings

Les Business Angels des Grandes Ecoles (BADGE)

investissent 73 k€ dans Peptinov

Huit membres de BADGE ont investi 73 k€ dans le financement de Peptinov, société de biotechnologie qui ambitionne de révolutionner le traitement des maladies inflammatoires chroniques et de l’arthrose. La start-up dispose d’un savoir-faire unique en bio-informatique et en immunologie. Elle modélise la structure 3D de ces protéines pour concevoir des produits qui vont stimuler le système immunitaire du patient et bloquer l’excès de protéines dans son organisme. A la levée de fonds de 950 k€ réalisée par Peptinov s'ajoute un prêt de Bpifrance de 400 k€. Grâce à ces moyens financiers, les tests cliniques Phase I pourront démarrer fin août à l’hôpital Cochin. 

ACCÉDER AU PROJET
 
 

Nos bureaux étant fermés du 10 au 31 août 2020, nous vous donnons rendez-vous en septembre, et vous souhaitons à toutes et tous un très bel été.

  N'oubliez pas de saines lectures estivales :

Retrouver sur notre site les Newsletters 2019 / 2020 qui vous auraient échappé !

J'Y VAIS !

Découvrez, redécouvrez  sur Linkedin les start-up financées par BADGE et ses adhérents avec la série «Un jour, une startup »

J'Y VAIS !
 

Les Business Angels des Grandes Écoles

Siège: 12 r. de Poitiers 75007 Paris

Bureaux: 15 r. du Colonel Driant 75001 Paris

Tél: 01 42 22 67 35

secretariat@business-angels.info

www.business-angels.info

       

>>> COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général Véronique Dupont  [Adressez votre sujet à la rédaction]

>>> Pour mettre à jour vos informations ou vous désabonner de notre newsletter <<<

 

Loguez vous pour ajouter un commentaire.


 
10
Juin
'20

Lettre d'information Externe Juin 2020 N°116

 

Lettre d'information externe Juin 2020 - N ° 116

 

EDITO

Retour vers le futur  

Chers Membres, chers lecteurs,

La pandémie régresse après trois mois pendant lesquels beaucoup de start-up se sont retrouvées complètement à l’arrêt.
Juste un retard de trois mois et tout recommence comme avant ? La première tentation est de le penser. Cela sera le cas pour certaines des sociétés que l’on accompagne.
Mais pour la plupart, le trou d’air est plus violent et les porteurs de projets doivent redéfinir leur stratégie et leurs priorités. L’exigence d’une gestion très économe de leur trésorerie les obligera peut-être à se concentrer sur les projets générant le plus de cash à court ou moyen terme et à différer des projets prometteurs.
Les PGE accordés devront être remboursés et souvent les start-up devront augmenter leurs fonds propres. Sur qui compter pour cela ?
- Sur les fonds ? Le Think Tank « The Galion Project » où sont représentées des entreprises qui ont déjà réalisé leurs séries A ou B, estime que l’investissement des fonds qui était en forte augmentation en 2019 baissera en 2020 et encore plus en 2021.
- Sur les BAs ? Oui bien sûr, mais ils sont comme les autres investisseurs, touchés dans leur capacité d’investissement. C’est pour cela que nous soutenons les mesures présentées par France Angels qui ont été reprises au sein d’une liste de mesures plus longues proposées par France Digitale pour que l’épargne soit orientée vers ces jeunes entreprises innovantes.
L’enjeu est grand. Selon Cédric O, le Secrétaire d’Etat au Numérique, qui se prononçait avant la pandémie, 12% de la création d’emplois nets en France devait venir des jeunes entreprises innovantes.
Amicalement,

Jacques Tamisier Président des Business Angels des Grandes Écoles

 
 

Olivier Blandin, un expert en assurances

Si pour la plupart des domaines d’activité (d’une entreprise), l’assurance de l’entreprise n’est pas obligatoire, elle n’en est pas moins fortement recommandée. Notamment créer son entreprise et lancer une nouvelle activité n’est pas sans risque !
Les risques liés à l’entreprise peuvent concerner :

  • Les personnes (le chef d'entreprise lui-même et ses collaborateurs) pour des risques comme la maladie, l'invalidité, le décès. On parlera dans ce cas de contrats d’assurance Santé et Prévoyance individuels ou collectifs. A noter dans cette catégorie, une Assurance spécifique : l’assurance Homme Clé destinée à protéger l’entreprise en cas de disparition d’une personne clé indispensable à son développement (dirigeant fondateur, développeur, CTO….)
  • Les biens de l'entreprise qui peuvent subir différents types de sinistres : incendie, vol, dégât des eaux,…. on parlera d’Assurance dommages et plus spécifiquement de MRP (multi-risque professionnelle),
  • Les dommages causés aux tiers, couverts par l'assurance de responsabilité, déclinée en Responsabilité Civile Professionnelle (RCP), ou encore des Responsabilité Civile des Dirigeants d’Entreprise (RCDE), 

Que faire pour choisir et sélectionner les couvertures d’assurance ?   Que l’on soit chef d’Entreprise ou investisseur, commencer par identifier les risques à couvrir, soit :

  • Analyser les risques encourus par l’entreprise,
  • Évaluer leur impact financier sur le développement et la pérennité de l’entreprise,
  • Ensuite, s’interroger sur ce qui reste à la charge de l’entreprise et ce qui pourrait être transféré à l’assureur. 

Cette démarche peut être menée en interne ou avec un partenaire : assureur, expert-comptable ou consultant. C'est une approche traditionnelle de gestion de risques accessible à tout dirigeant d’entreprise, qu’il s’agisse de TPE, PME, ETI, jeunes pousses ou entreprises plus mûres. L’important étant de bien personnaliser cette démarche et de l’adapter au profil du projet d’entreprise.   A titre d’exemple, une entreprise financée par fonds propres, n’aura pas les mêmes besoins en termes de RCDE (Responsabilité Civile des Dirigeants d’Entreprise) qu’une entreprise financée par des Investisseurs Fonds ou Business Angels. De même, en termes de protection des personnes clés au sein de la structure, la question de la mise en place d’une couverture d’assurance spécifique se pose différemment entre une PME familiale et une structure financée par des Business Angels.   S’agissant ensuite de la mise en place de couvertures d’assurance ad hoc, trois principaux acteurs interviennent : Courtiers, Agents généraux d’assurance, Bancassureurs.   Dans les faits, et pour une cible de clientèle spécifique comme des start-ups financées par des Business Angels, rien ne vaut les structures de courtage. Par leur accès diversifié au marché, elles sont plus à même de participer à la réflexion et d’offrir des panels larges de solutions répondant aux risques encourus par les Business Angels pour leur investissement dans des projets portés par une ou quelques personnes.   Depuis cette année, la structure de courtage ACCRMA a adhéré à BADGE afin de proposer en amont de l'investissement les couvertures intéressant les investisseurs : l’assurance Homme Clé et la Responsabilité Civile des Dirigeants d’Entreprise.   Vous souhaitez en savoir plus ? N’hésitez pas à contacter ACCRMA et son dirigeant, Olivier BLANDIN.  

 

Plus de 600 millions d'euros pour la French Tech

Le ministre de l'Economie et des Finances, Bruno le Maire, et le secrétaire d'Etat en charge du Numérique, Cédric O, annoncent un plan supplémentaire de plus de 500 millions d'euros pour soutenir la French Tech, ébranlée par la crise du Coronavirus

LIRE L'ARTICLE DE L'USINE DIGITALE
 
 
 

BADGE partenaire de l'événement organisé par la FoodTech qui a couronné 5 start-up au titre de leurs innovations participant à la transition alimentaire. Félicitations aux vainqueurs des cinq catégories : ElzeardDataswati, Le Chemin Des Mûres, LOUMAË, myLabel, à bientôt sur la plateforme BADGE.

PROCHAINS RENDEZ-VOUS

>>> PRÉSENTATIONS DE PROJETS

Réunions mensuelles avec présentation de projets innovants en recherche de fonds animées par Michel Huet, Secrétaire Général, chargé de l'Instruction. Réservées à nos adhérents. Non-adhérents, demandez votre invitation.

 

Mardi 16 juin 2020 à 17h30

Réunion en visio-conférence Zoom. Inscription obligatoire. Le code et le mot de passe pour cette réunion sera annoncé avec l’invitation.

S'inscrire
 

>>> COMITÉS DE SÉLECTION

Ces comités sont animés par François Levé, Vice-président, chargé de la sélection des projets innovants.

 

Mardi 30 Juin 2020 à 17h30   

Réunion en visio-conférence Zoom. Inscription obligatoire. Le code et le mot de passe pour cette réunion sera annoncé avec l’invitation.

S'inscrire

 
 
 

RÉSEAU ET PARTENAIRES
 

 

 Découvrez Alternatives, les 15 propositions de France Digitale sur 4 axes stratégiques pour réarmer technologiquement la France

  • Investir 10 milliards d'euros dans la transformation numérique
  • Créer des emplois durables et non délocalisables
  • Accélérer la transition écologique et numérique
  • Mobiliser 10 milliards d'euros d'investissements privés dans les start-up 
LIRE LE DOSSIER 
 

Nos derniers closings

 

Record battu pour BADGE et ses adhérents qui viennent de souscrire près de 1.4 M€ sur la levée globale de plus de 3M€ réalisée par CARDIAWAVE  auprès de ses réseaux de BA et investisseurs historiques. La start-up soutenue par BADGE dès sa création en 2014, a réussi une première mondiale en 2019 en traitant de manière non-invasive avec des ultrasons thérapeutiques des patients atteints de rétrécissement aortique calcifié. Les fonds levés permettront la poursuite de ces essais cliniques très prometteurs.

 
 
 

Les Business Angels des Grandes Écoles

Siège : 12 rue de Poitiers 75007 Paris

Bureaux : 15 rue du Colonel Driant 75001 Paris

Tél: 01 42 22 67 35

secretariat@business-angels.info

https://business-angels.info

       

COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général Véronique Dupont  [Adressez votre sujet à la rédaction]

Se désabonner">Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
10
Mai
'20

Lettre d'information Externe Mai 2020 N°115

 

Lettre d'information externe Avril 2020 - N ° 115

 

EDITO

A quelques jours du déconfinement

 

Chers Membres, chers lecteurs,

Le déconfinement est proche. C’est un soulagement pour tous mais nous l’aborderons avec prudence. Pour notre association, ce n’est qu’à la rentrée de septembre, nous l’espérons, que nous pourrons retrouver plus de convivialité dans nos Réunions Mensuelles de présentation de projets et Comités de Sélection.
Comme vous le savez, ces réunions sont maintenues en visioconférence via Zoom. Elles se passent bien, connaissent une bonne audience, avec de très beaux projets et des intentions d’investissement significatives. Depuis, le 17 Mars, début du confinement de nouveaux membres nous ont rejoint et participent à la vie de notre réseau.
Comme nous l’avons déjà évoqué dans la lettre d’information du mois précédent, nous essayons d’aider avec nos moyens les sociétés dans lesquelles nos membres ont investi : vous lirez avec intérêt dans l’article suivant, la synthèse qu’en fait Catherine Delcroix.
Le mois dernier, je vous avais indiqué qu’une douzaine de start-up de notre portefeuille contribuaient  à la lutte contre la pandémie. Nous leur souhaitons plein succès. Depuis le début du confinement, nous nous finançons ou avons financé une augmentation de capital de plusieurs d’entre elles.
Nous sommes préparés à présenter des dossiers de refinancement pour des sociétés pour lesquelles le choc est dur, leur activité étant à l’arrêt mais dont le busines model est solide. C’est le cas notamment des entreprises du secteur du tourisme. Mais également dans le secteur de la santé où toutes les études cliniques dans d’autres domaines que celui de la lutte contre la pandémie sont suspendues, ce qui pourrait durer malgré le déconfinement.
Enfin, le « monde de demain » sera différent. Il est possible que certaines activités soient relocalisées en France. Bien entendu, nous serons volontaires pour aider et financer dans leur démarrage les start-up qui se créeront pour relocaliser les activités à fort contenu d’innovation. Ce sera une des priorités de notre Sourcing.
Continuez à bien vous protéger et à protéger les autres, et bon déconfinement.
Jacques Tamisier Président des Business Angels des Grandes Écoles

 

La crise, et après?  

Catherine Delcroix, Vice Présidente BADGE, en charge de l’Accompagnement.
Notre réseau s’est appuyé sur ses accompagnateurs pour mesurer les impacts de la crise sanitaire sur les start-up dans lesquelles nos adhérents ont investi, et préparer les besoins en financement à la sortie de crise.

Il n’est bien sûr pas question de faire des statistiques sur un tel nombre, mais des tendances fortes se dessinent.
La quasi-totalité des sociétés prévoient une activité ralentie en 2020. Elles ont pratiquement toutes pris des mesures pour protéger leur trésorerie, en s’appuyant sur le panel d’aides mises en place par l’état. Un tiers d’entre elles ont malgré tout une réserve de trésorerie inférieure à 6 mois, et plus d’un tiers ont plus de 12 mois de trésorerie disponible.
75% des entrepreneurs interrogés estiment que la crise est un évènement ponctuel sans incidence à moyen terme ; 15% y voient une opportunité d’accélérer le business et seuls 10% pensent que ce sera un coup de frein durable.
Enfin, moins d’un quart des entrepreneurs envisagent une levée de fonds significative fin 2020 ou début 2021.
Nous constatons que les entrepreneurs que nous accompagnons font tous preuve de résilience, et d’une forme d’optimisme face aux conséquences de cette crise inédite. Et si la grande majorité d’entre eux déclarent que la crise est un évènement ponctuel sans incidence à moyen terme, nous pensons que, cette consultation ayant eu très tôt après le début de la crise, il n’y avait pas encore eu de temps pour une réflexion stratégique poussée sur « après ne sera plus comme avant », et sur le meilleur parti à tirer lors de la reprise de l’activité.
Nous sommes confiants, cette phase viendra, avec le soutien de nos accompagnateurs, et nous espérons pouvoir en tirer des conclusions positives.

 

Des Prêts Garantis par l’État plus facilement accessibles pour nos start-up.

Le ministère de l’Économie et des Finances a publié le 23 Avril 2020 une note très complète sur les Prêts Garantis par l’État. C’est un document de référence pour toutes les entreprises souhaitant demander un PGE à leur banque. En plus d’apporter toutes les précisions pratiques pour effectuer sa demande avec une partie Questions-Réponses très complète, elle permet aux banques de pouvoir accorder des prêts plus facilement dans quelques cas, où elles n’étaient pas assurées de pouvoir bénéficier de la garantie de l’État.   La garantie irrévocable et inconditionnelle aux banques n’est pas remise en cause en cas d’octroi d’un PGE à une TPE ou PME répondant à au moins un des critères européens définissant une entreprise en difficulté, à l’exception du critère d’être en procédure collective au 31/12/2019.   Cela signifie qu’une banque qui octroie un PGE à une entreprise dont, par exemple, les fonds propres sont négatifs au 31/12/2019, ou inférieurs à la moitié de son capital social, ne s’expose en aucune manière à une éventuelle annulation ou déchéance de la garantie de l’État sur ce seul motif.   Par voie de conséquence, pour les TPE et les PME, la vérification par les banques au regard de la définition d’entreprises en difficulté au sens communautaire ne porte que sur le fait de ne pas être en procédure collective au 31/12/2019.   Cet engagement a été particulièrement utile à plusieurs sociétés que nous accompagnons et qui ont pu ainsi obtenir leur prêt.  

LIRE LE DOSSIER DE PRESSE

PORTEURS DE PROJET, rejoignez nous !  

 

DEVENIR BA, pourquoi pas vous ?  

 

L’aventure vous tente, vous souhaitez découvrir notre activité, notre équipe pour vous présenter notre structure et son fonctionnement avant de vous inscrire? Restez connecté à l’écran et assistez à une réunion mensuelle, présentation de projets innovants, en visioconférence. Nous vous invitons, pour une seule session.  Inscrivez-vous dès à présent : Je demande mon invitation à la Présentation de Projets du Mardi 19 mai 2020 à 17h30

PROCHAINS RENDEZ-VOUS

>>> PRÉSENTATIONS DE PROJETS

Réunions mensuelles avec présentation de projets innovants en recherche de fonds animées par Michel Huet, Secrétaire Général, chargé de l'Instruction. Réservées à nos adhérents. Non-adhérents, demandez votre invitation.

 

Mardi 19 mai 2020 à 17h30

Réunion en visio-conférence Zoom. Inscription obligatoire, nous vous enverrons en retour le code et le mot de passe pour cette réunion.

S'inscrire

Bpifrance et la Région Ile-de-France ont débloqué la plateforme pour le Prêt Rebond

 

Des prêts entre 10 000 € et 50 000 € sans aucune garantie et sans intérêt

  • montant compris entre 10 et 50 k€, 
  • souscription 100 % en ligne sur une page dédiée 
  • recherche d’un cofinancement bancaire au moins égal (PGE par exemple), 
  • remboursable sur 7 ans, après 2 ans de différé,
  • taux  0 %, aucune sûreté ni garantie, aucun frais de dossier.
 
ZZZ
Sur la même période, The Galion Project, Think-Tank de référence des entrepreneurs de la Tech française en hyper-croissance, a souhaité mesurer les impacts de la crise sanitaire à court et moyen terme sur les entreprises de sa communauté. Cette étude, basée sur une enquête quantitative auprès de 144 entrepreneurs début avril 2020, a été publiée par J.B. Rudelle.
 EN SAVOIR PLUS
 
 

RÉSEAU ET PARTENAIRES  

 

Retrouvez le Communiqué de presse du 6 mai 2020 [Covid-19]
Les Business Angels sont à l’offensive !!!
 

Dans le contexte de la crise sanitaire et du ralentissement brutal de l’économie européenne et mondiale, la Fédération France Angels qui a appelé les 5 500 Business Angels de France à se mobiliser pour être présents au côté des start-ups et des PME qu’ils accompagnent, à les soutenir par tous moyens financiers et humains pour préserver leurs chances de développement. France Angels évoque "Les Business Angels des Grandes Ecoles qui ont, au plus fort de la crise, clôturé des investissements dans trois sociétés : RheonovaMa Formation MédicaleCarJager".  

   LIRE LE COMMUNIQUE   

 

Nos derniers closings

 

CarJager  vient de réaliser une levée de fonds de 138k€ auprès de 12 adhérents et de la SIBA BADGE. La levée globale de 1 085 000 €  a été réalisée auprès d'investisseurs historiques de la société et du seul réseau BADGE sollicité par CarJager.  Cette start-up propose l'outil digital le plus pointu pour l'achat et la vente de voitures de collection (classic, youngtimers et supercars). Considéré comme un marché de niche, l'automobile de collection est un marché mondial représentant 50 milliards d'euros par an où aucun acteur global digital n'a encore émergé.

 
 

 

 

Les Business Angels des Grandes Écoles

Siège : 12 rue de Poitiers 75007 Paris

Bureaux : 15 rue du Colonel Driant 75001 Paris

Tél: 01 42 22 67 35

secretariat@business-angels.info

https://business-angels.info

       

COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général Véronique Dupont  [Adressez votre sujet à la rédaction]

 

Loguez vous pour ajouter un commentaire.


 
20
Avril
'20

Communiqué de presse Les Business Angels des Grandes Ecoles investissent dans Rheonova

                                              

 
 
COMMUNIQUÉ DE PRESSE
 
 
 
Les Business Angels des Grandes Ecoles (BADGE) investissent 178 k€ dans Rheonova, créateur du dispositif Rheomuco dédié aux maladies pulmonaires chroniques.
 

Paris, le 16 avril 2020
BADGE (Les Business Angels des Grandes Ecoles) annonce un nouvel investissement de ses membres et de sa SIBA 2019 dans Rheonova, société grenobloise, en association avec le réseau Grenoble Angels et la plateforme Sowefund. Rheonova est spécialisé en rhéologie et commercialise Rheomuco, dispositif d’étude des propriétés viscoélastiques du mucus broncho-pulmonaire, dédié aux maladies pulmonaires chroniques.   Rheonova obtient 430 K€ de financement pour son 1er tour de table Créée en 2014, avec l’appui de Floralis-UGA filiale, Rheonova se développe autour d’un business model mixte avec d’une part une activité d’analyses et de conseils scientifiques www.rheonova.fr, et d’autre part la conception et réalisation de dispositifs de mesures innovants centrés sur les besoins des utilisateurs, en collaboration avec le Laboratoire Rhéologie et Procédés (UMR 5520 : CNRS/Grenoble INP/Université Grenoble-Alpes). Rhéonova conçoit et commercialise le Dispositif Médical de Diagnostic In Vitro Rheomuco qui évalue la congestion bronchique, par une technologie innovante de rupture basée sur la rhéologie www.rheomuco.com.

  Ce financement va permettre de poursuivre la validation clinique et la commercialisation de Rheomuco, dispositif dédié aux maladies pulmonaires chroniques et cette levée complète le soutien financier de 352 000 € du Programme Investissement d’Avenir (PIA3) pour le projet « MucoCF.

Réalisé avec Rheomuco®, le test repose sur la mesure de propriétés physiques du mucus pulmonaire. Le bénéfice médical attendu est la réduction du nombre des hospitalisations et des coûts associés. L’étude clinique aura lieu dans le service du Professeur Pierre-Régis Burgel de l’Hôpital Cochin, à Paris.   Investissement conjoint de 2 réseaux de Business Angels et de Sowefund, le tour de table a rassemblé :
- BADGE qui apporte 178k€, - Grenoble Angels qui apporte 25K€, - Sowefund à hauteur de 227 k€ Les investisseurs s’emploieront à travers le comité stratégique à favoriser la réussite de Rhéonova.  

 
 
 
 
 

A propos des Business Angels des Grandes Écoles (BADGE) :

 

Créée en 2004 par des associations d’anciens élèves des Grandes Ecoles, l'association les Business Angels des Grandes Ecoles, devenue un des 1ers réseaux de Business Angels en France, est ouverte à toute personne ayant l’expérience professionnelle et la capacité financière requise pour devenir Business Angel. Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, ce réseau, ouvert à tout projet innovant sans restriction quand à la formation initiale des porteurs de projet :

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • Noue des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement des jeunes entreprises financées,
  • Facilite la création de groupes de Business Angels.

Ses adhérents, aux expériences professionnelles reconnues, ont en 2019 soutenu 25 entreprises par des apports de capitaux propres à hauteur de 2,5 M€. Depuis 2005, 400 Business Angels des Grandes Ecoles ainsi ont financé 175 entreprises en apportant près de 32 M€ qui, par effet de levier sur d'autres sources de financement, ont généré près de 100 M€ d'apport de capitaux.

 

 En savoir plus : https://business-angels.info/ Contact Presse : Paul Leondaridis (Délégué Général) paul.leondaridis@business-angels.info  -  06 19 72 77 56 Business Angels des Grandes Ecoles (BADGE) 15 rue du Colonel Driant – 75001 Paris
A propos de Rheonova : 

Rheonova conçoit et commercialise le Dispositif Médical de Diagnostic In Vitro, Rheomuco qui évalue la congestion bronchique, par une technologie innovante de rupture basée sur la rhéologie. Créée en 2014, avec l’appui de Floralis-UGA filiale, Rheonova se développe autour d’un business model mixte avec d’une part une activité d’analyses et de conseils scientifiques,  et d’autre part la conception et réalisation de dispositifs de mesures innovants centrés sur les besoins des utilisateurs, en collaboration avec le Laboratoire Rhéologie et Procédés (UMR 5520 : CNRS/Grenoble INP/Université Grenoble-Alpes). Rheonova compte une dizaine de collaborateurs et est dirigée par Jérémy PATARIN, lauréat du Réseau Entreprendre Isère. La société est soutenue par Bpifrance (lauréat i-LAB2017) et le réseau Européen EIT Health. Elle s’insère dans le réseau de partenaires scientifiques, cliniques et techniques du bassin grenoblois. Rheonova est membre de Medicalps, Lyonbiopole et Medicen.

  Contact : Christelle Lamoine - lamoine@rheonova.fr  - 06 62 18 00 35 Rheonova | 1270 rue de la piscine | 38400 Saint Martin d’Hères | 04 76 82 70 07  

 
Se désabonner">Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
10
Avril
'20

Lettre d'information Externe Avril 2020 N°114

 

Lettre d'information externe Avril 2020 - N ° 114

 

EDITO

Plus que jamais aux côtés des start-up

 

Chers Amis Business Angels, chers lecteurs,

Tout d’abord, je vous espère tous en bonne santé.
Malgré la période exceptionnelle que nous traversons, l’équipe de BADGE reste mobilisée et continue d'être aux côtés des start-up que nous avons financées ou qui sont en instruction.
Nos accompagnateurs sont au cœur de l’action. Dès les premières mesures gouvernementales de soutien à l’économie annoncées, ils ont envoyé aux dirigeants des sociétés qu’ils accompagnent une note pratique expliquant comment en bénéficier.
Nous leur demandons actuellement à tous une note de synthèse sur l’impact de la pandémie sur les sociétés qu’ils accompagnent, sur les mesures prises et si un apport en fonds propres est nécessaire et dans quel délai afin que ces sociétés puissent traverser cette période difficile. A n’en pas douter, beaucoup de refinancements de nos start-up seront présentés. Nous devons avoir une idée des besoins et peut-être les prioriser dans le temps.
Pour dégager les ressources nécessaires et motiver les membres des réseaux à investir, France Angels communique aux décideurs que beaucoup de sociétés vont devoir renforcer leurs fonds propres et qu'à cet effet il est indispensable d'améliorer les mesures de défiscalisation existantes, à la fois le taux de déduction et le montant par part fiscale. Cette mesure devra sans doute être négociée et la demande documentée ; toutes les remontées que nous recevrons serviront à appuyer la demande de France Angels.
Par ailleurs, nous continuerons à organiser nos réunions en ligne, Comités de Sélection et Réunions Mensuelles pendant toute la période de confinement.
Lors de notre dernière réunion mensuelle du 17 Mars, plus de 40 personnes se sont connectées en visioconférence et assisté à la présentation de quatre projets : - Peptinov - Biotechnologie, traitement des maladies inflammatoires chroniques et de l’arthrose,  - Vitaline - Foodtech, aliments complets de qualité nutritionnelle exceptionnelle, - Orasis - Dispositif médical pour résoudre les problèmes de vue entraînant des troubles de l’apprentissage, - Ecrins Therapeutics - Molécule anti-cancéreuse pour un bridge avant l’entrée de fonds en série A.
Ces quatre projets ont recueilli d’excellentes notes et les premières intentions d’investissement. Si vous n’avez pu participer à cette réunion, je vous invite à consulter ces projets sur notre site.
Le moment est délicat, ne nous démobilisons pas, les start-up ont plus que jamais besoin de nous. Respectez bien toutes les consignes de confinement et protégez vous bien.  

Jacques Tamisier Président des Business Angels des Grandes Écoles

 
Notre communication sur LinkedIn : « Un jour, une start-up »

En ces temps confinés, BADGE vous propose de (re)découvrir sur LinkedIn les start-up financées par ses adhérents.

 

Découvrez chaque jour le nouveau post d'une start-up que nous avons financée. Likez, publiez vos commentaires, invitez vos ami(e)s à découvrir notre Post sur une société différente de notre portefeuille résumant en quelques lignes son activité et si vous découvrez une nouveauté, diffusez à vos contacts
Ces projets novateurs devenus réalité grâce à la pugnacité des créateurs, porteurs de projets visionnaires, accompagnés dans leur développement par le professionnalisme des instructeurs BADGE, et les financements de ses adhérents sont à découvrir chaque jour sur le compte LinkedIn : BADGE Business Angels des Grandes Ecoles
N’hésitez pas à liker et partager, cette série commencée le 24 Mars 2020.

ONCODIAG : tests de diagnostic précoce et de surveillance du cancer, - AUXIVIA : e-santé au service des personnes âgées, - ECRINS THERAPEUTICS : développement de la molécule anti-cancéreuse ET-D5, - KAZOART : galerie et vente d’art en ligne, - ROGERVOICE : application pour malentendants, - OPTINVENT : technologie d’affichage de nouvelle génération pour la réalité augmentée, - ALGENTECH : solutions technologiques pour améliorer les plantes, produire des pesticides naturels et des composés thérapeutiques au cœur de la cellule végétale. - KINVENT Biomécanique : capteurs connectés et plateforme applicative pour améliorer la prise en charge de la rééducation fonctionnelle,

HEMARINA : transporteurs d'oxygène issus de l'hémoglobine du ver marin (arénicole). Sa molécule Hemo2life, possède une capacité oxygénante 40 fois supérieure à celle de l'hémoglobine de vertébrés qui pourrait contribuer à sauver des malades du Coronavirus. - OROSOUND : nouvelle génération de casques anti-bruit pour le télétravail ou les bureaux bruyants en open-space, - WATCHA : éditeur de logiciel proposant une application de collaboration sécurisée d’entreprise offrant messagerie instantanée, voix/téléconférence, documents, sur mobile et ordinateur.

 

UN NOUVEAU MEMBRE

ASSOCIE PROFESSIONNEL REJOINT L'ÉCOSYSTEME

BADGE : ACCRMA

ACCRMA est courtier en assurances offrant une solution complète de couverture de risques pour les investisseurs et les start-up qu'il accompagne. L'actualité ce cette lettre étant centrée sur les conséquences de la crise sanitaire, le portrait d'Olivier BLANDIN, son dirigeant,  sera publié dans la prochaine édition.   

Face à la crise actuelle du Covid-19, les assureurs accompagnent leurs clients par la mise en place de mesures spécifiques, pour simplifier la gestion des contrats et des sinistres. A titre d’exemple, certains assureurs de personnes annoncent la suppression du délai de franchise dans certains contrats de prévoyance. D’autres assureurs généralistes, pour alléger la trésorerie de leurs clients, allongent les délais de mises en demeure et permettent la mensualisation gratuite. De même, en cas de fermeture totale de sites, les garanties des contrats couvrant les locaux peuvent être maintenues, y compris en cas d’inoccupation prolongée du site, et sous réserve de maintien des moyens de prévention / protection prévus au contrat.
Chaque assureur développe son propre jeu de mesures de soutien, aussi les dirigeants d'entreprise sont invités à prendre contact avec leurs assureurs pour toutes demandes d’information complémentaire.
Les assureurs ont également alimenté à hauteur de 200 Millions d'Euros le fonds de solidarité mis en place par l’État en faveur des petites entreprises en crise.
Face à l'explosion des demandes d'indemnisation, Florence Lustman, Présidente de la Fédération Française de l’Assurance a publié une tribune exposant la position des assureurs et détaillant les actions prises par ses membres.

LIRE L'ARTICLE

PORTEURS DE PROJET, rejoignez nous !  

 

DEVENIR BA, pourquoi pas vous ?  

 

L’aventure vous tente, vous souhaitez découvrir notre activité, notre équipe pour vous présenter notre structure et son fonctionnement avant de vous inscrire? Restez connecté à l’écran, et assistez à une réunion mensuelle, présentation de projets innovants, nous vous invitons. Inscrivez-vous dès à présent pour une seule session :

PROCHAINS RENDEZ-VOUS

>>> PRÉSENTATIONS DE PROJETS

Réunions mensuelles avec présentation de projets innovants en recherche de fonds animées par Michel Huet, Secrétaire Général, chargé de l'Instruction. Réservées à nos adhérents. Non-adhérents, demandez votre invitation.

 

Mercredi 29 avril 2020 à 17h00

Réunion en visio-conférence Zoom. Inscription obligatoire, nous vous enverrons en retour le code et le mot de passe pour cette réunion.

S'inscrire

Plusieurs start-up financées par BADGE mobilisées dans la lutte contre le Coronavirus

 

Nous sommes particulièrement fiers de la mobilisation de certaines sociétés de notre portefeuille pour contribuer à la lutte contre le Coronavirus : Hemarina, qui fait l'objet d'une très grande couverture médiatique (presse, TV, radio) pour sa molécule issue de vers arénicoles actuellement testée en réanimation pour oxygéner directement le sang, en substitution aux « respirateurs » qui viendraient à manquer. B Cell Design, sollicitée par le Professeur Denis Malvy, Conseiller auprès du Ministre de la Santé pour développer une approche immuno-thérapeutique aérosol pulmonaire anti-Coronavirus SARS-Cov2.   Rogervoice qui fournit des services de téléphonie aux sourds et malentendants avec traduction par interprète en lignes des signes ou par sous-titrage des échanges offre une heure de communication supplémentaire par sous-titrage aux malentendants qui peuvent souffrir beaucoup plus que d’autres du confinement. Inex qui a développé en un temps record une plateforme de mise en relation entre fabricants de gel, entreprises qui peuvent fournir les éléments nécessaires à leur fabrication et entités utilisatrices Watcha qui met gratuitement à disposition des entreprises, dans sa solution Secure Digital Workplace, ses services de télé-réunion et de communication sécurisés, unique solution de travail collaboratif centrée sur le transfert hautement sécurisé des documents. Wefight qui enrichit sa plateforme de mise en relation entre malades (ou proches de malades) ou entre malades et professionnels de santé par des informations spécifiques pour gérer l’asthme, la dépression, la migraine et les cancers dans le contexte du Covid-19. Auxivia qui maintient son service de verres intelligents pour éviter la déshydratation des personnes âgées et soulager les personnels en Ehpad. Nanoe utilise sa technologie d’impression 3D plastic et céramique Zetamix pour contribuer à la fabrication de pièces pour des dispositifs médicaux et de visière pour les soignants pour les Hôpitaux de la Région Parisienne. Telegrafik : ses solutions connectées apportent une réelle valeur ajoutée pour les personnes âgées ou fragiles en confinement afin de garantir leur sécurité et la sérénité de leurs proches. Worldcrunch qui rend gratuits tous les articles relatifs au Coronavirus sur sa plateforme B2C qui publie les articles des meilleurs titres de la presse mondiale.

 
 

INFO PRATIQUE

Membres Actifs et Membres de Suivi, découvrez, perfectionnez votre connaissance du nouveau Site de suivi des entreprises qui résume toutes les informations utiles sur les sociétés dans lesquelles vous avez investi. Le Site de suivi est régulièrement actualisé par les accompagnateurs.

RÉSEAU ET PARTENAIRES  

 

DISPOSITIFS DE SOUTIEN AUX START-UP
Retrouvez les informations de notre Fédération France Angels : Communiqué de presse et toutes les mesures pour soutenir les start-up.

LIRE LE COMMUNIQUÉ
 

Nos derniers closings

 

RHEONOVA  vient de réaliser une levée de fonds auprès de BADGE, réseau leader aux cotés de Grenoble Angels. Cette start-up commercialise Rheomuco, un appareil de mesure de la viscosité du mucus bronchique dédié à l'étude et à la prévention des maladies respiratoires chroniques: mucoviscidose, bronchites obstructives (BPCO), asthme.

 
 

Ma Formation Médicale développe une plateforme qui référence l’ensemble de offres de DPC (Développement Professionnel Continu) pour tous les professionnels de santé tenus par le cadre réglementaire, de se former tout au long de leur carrière. Partenaire de plus de 200 organismes de formation, MFM qui a permis la formation de près de 2000 stagiaires. Sa levée de fonds auprès de BADGE, d'Angels Santé et de fonds privés régionaux lui permettra de poursuivre sa croissance avec le développement  de nouveaux produits et de services au niveau national et international.  

 

Les Business Angels des Grandes Écoles

Siège : 12 rue de Poitiers 75007 Paris

Bureaux : 15 rue du Colonel Driant 75001 Paris

Tél: 01 42 22 67 35

secretariat@business-angels.info

https://business-angels.info

       

COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général Véronique Dupont  [Adressez votre sujet à la rédaction]

Se désabonner

Loguez vous pour ajouter un commentaire.


 
10
Mars
'20

Lettre d'information Externe Mars 2020 N°113

 

Lettre d'information externe Mars 2020 - N ° 113

 

EDITO

Chers Amis Business Angels, chers lecteurs,

"L'enthousiasme de la réussite et le doute de l'échec. L'aventure". Cet extrait des écrits de Walter Bonatti, peut-être le plus grand alpiniste de tous les temps, peut sans doute s’appliquer à notre activité. 

Il illustre bien les moments de la vie des entrepreneurs qui créent leur start-up, qui doivent affronter incertitudes et difficultés avec endurance, clairvoyance et courage. Mais également aussi aux Business Angels qui participent à leur financement. Si l’entrepreneur est le premier de cordée, les BAs sont aussi des aventuriers, dans un rôle de second de cordée qui apportera son soutien et ses conseils dans cette aventure.
Bien sûr, nous avons dû affronter nos doutes et nos échecs, toutes les start-ups n’ayant pas pu rencontrer le succès escompté au démarrage. Nous le savions. Mais il y a aussi beaucoup de réussites. En ce début d’année 2020, deux très belles levées de fonds en cours sur des sociétés accompagnées par de nombreux membres de BADGE, sur des valorisations importantes et avec des espoirs de plus-value importante nous permettent de partager l’enthousiasme de la réussite que doivent ressentir les porteurs de projets, et la satisfaction de penser que sans notre investissement initial certaines de ces sociétés n’existeraient pas.
Ce ne sont pas les seules, de très beaux projets dans des domaines bien différents sont déjà en instruction ou le seront cette année. Si vous n’êtes pas déjà membre de BADGE, rejoignez-nous, venez partager notre aventure.

Jacques Tamisier Président des Business Angels des Grandes Écoles

 

PORTRAIT

Un projet de couple : s’investir dans des startups du Greentech en adhérant à BADGE

Marie-Ange du Mesnil du Buisson - Sciences Po 77, ENA 81, Inspectrice générale des affaires sociales honoraire

Christian Nguyen-Van-Yen - Mines de Paris 73, Sciences Po 76, ENA 81, Conseil en propriété industrielle

 

Nous nous sommes connus à l’ENA et avons commencé nos carrières professionnelles ensemble à l’Inspection générale des affaires sociales, puis elles ont divergé, Marie-Ange restant fidèle au service public jusqu’à la retraite et Christian quittant l’administration pour faire carrière chez Thales, puis fonder un cabinet de propriété industrielle.
Nous avons eu la chance de prendre notre retraite en pleine santé, avec un petit capital et un fort intérêt pour la création d’entreprise et l’innovation. Nous avons conçu ensemble le projet d’investir une partie dudit capital, de notre temps, de notre énergie et de nos réseaux dans des startups du domaine Greentech. C’est en effet une dimension importante de notre projet commun d’apporter une contribution financière et intellectuelle au développement de solutions pour la transition énergétique. Nous étions conscients de la nécessité d’avoir accès à un « deal-flow » de projets et de nos limites pour y arriver tout seuls.
Après avoir échoué à entrer en contact avec un réseau de Business Angels spécialisé dans les « greentech », nous avons fait la connaissance de BADGE fin 2018 à un moment où Paul Leondaridis venait de prendre ses fonctions de Délégué général. Nous avons été très bien accueillis et y avons trouvé des compétences, des outils, des méthodes et des projets nous permettant de faire un apprentissage accéléré du métier de Business Angel et d’investir dans trois projets en 2019 (plus un tout début 2020) : Immoblade, Agripolis, Resair et Inex.
Etre BA, c’est pratiquer à une échelle modeste (quelques milliers ou dizaines de milliers d’euros par dossier), ce que le gourou du private equity, Warren Buffet, nomme le « value investing », c’est-à-dire l’opposé des critères d’arbitrage purement financiers (projections macroéconomiques, évolution des cours de bourse et des volumes d’échange, options rationnelles, etc…) qu’appliquent les gestionnaires de portefeuilles des banques sans considération des qualités intrinsèques de l’entreprise investie. Le value investing consiste à sélectionner des entreprises ayant des produits qui répondent à de vrais besoins pérennes (dans notre cas contribuant à la transition énergétique), disposant d’avantages compétitifs durables et dirigées par des équipes compétentes et honnêtes. Il consiste aussi à investir dans la durée, typiquement de 5 à 10 ans. La difficulté consiste à se faire une opinion sur des produits non encore validés commercialement et des équipes qui ont encore à démontrer leur valeur…
D’où l’intérêt de pouvoir croiser les avis au sein d’un réseau d’investisseurs expérimentés tel que BADGE. Nous ne savons pas encore si l’expérience sera financièrement enrichissante mais nous savons déjà qu’elle l’est humainement par la qualité des personnes rencontrées, aussi bien les autres membres de BADGE que les porteurs de projet et par la confrontation des points de vue entre nous deux.

 

INVITATION

RÉUNION ANNUELLE MARDI 24 MARS 2020

BADGE fête ses 15 ans

Cette année encore BADGE aura la joie de convier ses adhérentes, adhérents et tous les BA potentiels à partir de 18h00 dans les locaux de ODDO BHF qui accueille notre événement annuel.
Ce dernier sera l’occasion de fêter les 15 ans de notre association, un moment rare pour découvrir l’éco système de BADGE, l’équipe de bénévoles qui l’anime, les projets qu’ils ont sélectionnés, instruits, et les porteurs de projets qu’ils ont accompagné jusqu’à la levée de fonds.
Au cours de cette soirée de prestige, après l’accueil des participants par les présidents d’ODDO BHF Banque privée et BADGE, Jean-Michel Fourgous, Maire d'Elancourt et président de SQY ainsi que Jean-Marc Daniel, économiste et professeur à l'ESCP, nos invités d’honneur, s’exprimeront sur l’économie. Puis les neuf entreprises financées en premier tour en 2019 exposeront leur vécu sur l’apport des Business Angels à leur projet.
Un cocktail d'échange en fin de réunion sera un moment de networking.
Adhérents, cet événement est l’occasion de faire connaître BADGE et susciter des vocations de BA. Parlez-en à vos amis intéressés par l'activité des Business Angels, ils sont les bienvenus !

INFORMATIONS ET INSCRIPTIONS : 01 42 22 67 35 ou secretariat@business-angels.info

PORTEURS DE PROJET, rejoignez nous !  

 

DEVENIR BA, pourquoi pas vous ?  

 

L’aventure vous tente, vous souhaitez découvrir notre activité, notre équipe pour vous présenter notre structure et son fonctionnement avant de vous inscrire? Passez de l’autre côté de l’écran, et venez assister à une réunion mensuelle, présentation de projets innovants, nous vous invitons. Inscrivez-vous dès à présent pour une seule session :

PROCHAINS RENDEZ-VOUS

>>> PRÉSENTATIONS DE PROJETS

Réunions mensuelles avec présentation de projets innovants en recherche de fonds animés par Michel Huet , Secrétaire Général, chargé de l'Instruction. Réservées à nos adhérents. Non-adhérents, demandez votre invitation.

 

Mardi 17 mars 2020 à 17h30

Le Centorial - Campus EDHEC Alumni de Paris

18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d'un cocktail. Inscription obligatoire, se munir d'une pièce d'identité.

S'inscrire
 

Mardi 28 avril 2020 à 17h30

Le Centorial - Campus EDHEC Alumni de Paris

18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d'un cocktail. Inscription obligatoire, se munir d'une pièce d'identité.

S'inscrire

Retrouvez nos prochaines dates de réunion en 2020:

https://business-angels.info/actualites

Retour sur la première étape

du France Angels Tour 2020

 

Depuis 5 ans France Angels organise des soirées thématiques sur le métier de Business dans toute la France. La première étape du Tour 2020 s'est tenue le 26 février à Paris. Après l'ouverture de la réunion par Guy Gourevitch, Président de France Angels, une première table ronde met en scène Agripolis, start-up en forte croissance financée par BADGE depuis 2017.
Agripolis installe des fermes urbaines sur les toits des bâtiments. François Renevier, Busines Angel accompagnateur BADGE pour cette société a témoigné sur son engagement : "Etre Business Angel est une aventure". Une première intervenante de BNP Paribas Banque Privée a passé en revue les mesures fiscales autour des investissements dans les PME non cotées, et détaillé les mesures d’assouplissement contenues dans la loi PACTE : titres participatifs et mini bons sont maintenant autorisés dans un PEA PME mais toujours pas les Bons de Souscription d'Actions.
Le public présent a pu assister à deux pitchs d'entreprises en recherche de financement : Jubiles qui révolutionne le kombucha, et SAIL.cloud qui permet de suivre les épreuves nautiques sur son portable. Alain Pujol, administrateur d'Angels Santé et secrétaire du Copil des BAs franciliens en fait le bilan pour 2019. BADGE se classe à nouveau 1er réseau d'île de France. Guy Gourevitch et Béatrice Belorgey, Directrice de BNP Paribas Banque Privée ont clôturé la réunion qui s'est poursuivie par un cocktail convivial permettant aux participants de prolonger la discussion.

RÉSEAU ET PARTENAIRES  

 

Université de Printemps France Angels le 30 & 31 mars 2020
L'occasion, chaque semestre, de faire le bilan de l'activité des Business Angels sur les derniers mois, d'aborder les sujets d'actualité du monde du financement des start-up et de réunir la communauté pour encourager les échanges et les rencontres en son sein.

PROGRAMME DÉTAILLÉ ET INSCRIPTION
 

Nos derniers closings

 

Les Business Angels des Grandes Ecoles (BADGE)

investissent 91 k€ dans WATCHA

Watcha® annonce avoir finalisé une levée de fonds de 1 million d’euros qui va lui permettre enparticulier d’accélérer son développement commercial. Cette opération soutenue par Bpifrance àhauteur de 400 k€ a été menée conjointement avec des membres du club Holnest, des Business Angels de l’ESCP Business School, et les Business Angels Des Grandes Ecoles qui ont participé à hauteur de 91 k€

LIRE LE COMMUNIQUÉ
 
 

Telegrafik accélère son développement

et lève pour la deuxième fois 1 million d’euros

Dans le cadre de cette levée de fonds, Telegrafik a pu bénéficier de la confiance renouvelée de ses investisseurs historiques (notamment Citizen Capital, Aviva Impact Investing France, et le réseau BADGE), mais aussi de l’arrivée de nouveaux investisseurs, parmi lesquels Vessoa, Philippe Carle, ainsi que la communauté LITA.co attachée à l’impact sociétal fort de l’entreprise. Grâce à cette levée de fonds, Telegrafik accélère son développement, autour de ses trois produits phares : Otono-me EHPAD, Otono-me Domicile et Résidences et Otono-me EHPAD à Domicile. « Nous équipons déjà plus de 1000 chambres d’EHPAD, et nos solutions remplissent clairement leurs objectifs : améliorer le confort de travail des personnels qui sont informés au bon moment en cas de chute, et sécuriser les résidents. Nous souhaitons maintenant les étendre à un grand nombre d’établissements, qui grâce à nous, accompagneront mieux leurs résidents fragiles ou âgés. » explique Carole Zisa-Garat, Présidente de Telegrafik. Chaque mois, environ 250 chutes sont détectées par Telegrafik et envoyées vers des professionnels, et 83% des seniors interrogés s’accordent sur le fait qu’ils se sentent beaucoup plus rassurés.

LIRE LE COMMUNIQUÉ
VOIR LA VIDÉO
 

Les Business Angels des Grandes Écoles

Siège: 12 r. de Poitiers 75007 Paris

Bureaux: 15 r. du Colonel Driant 75001 Paris

Tél: 01 42 22 67 35

secretariat@business-angels.info

www.business-angels.info

       

>>> COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général Véronique Dupont  [Adressez votre sujet à la rédaction]

Se désabonner " style="-webkit-text-size-adjust:none;-ms-text-size-adjust:none;mso-line-height-rule:exactly;font-family:arial, 'helvetica neue', helvetica, sans-serif;font-size:12px;text-decoration:underline;color:#999999;" target="_blank">Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
10
Mars
'20

Communiqué de presse_Les Business Angels des Grandes Ecoles investissent dans Watcha

                                              

 
 
COMMUNIQUÉ DE PRESSE
 
 
 
Les Business Angels des Grandes Ecoles (BADGE) investissent 91 k€ dans WATCHA  
 

Paris, le 27 février 2020
Watcha® annonce avoir finalisé une levée de fonds de 1 million d’euros qui va lui permettre en particulier d’accélérer son développement commercial. Cette opération soutenue par Bpifrance à hauteur de 400 k€ a été menée conjointement avec des membres du club Holnest, des Business Angels de l’ESCP Business School, et les Business Angels Des Grandes Ecoles (BADGE) qui ont participé à hauteur de 91 k€.
Intégrée au programme start-up de Microsoft, Watcha® vient en complément de la plateforme Teams et se pose en intermédiaire de confiance pour ses utilisateurs : avec la technologie développée par Watcha, ils ont la garantie qu’aucun tiers ne peut accéder à leurs données et échanges, sans compromis sur la facilité d’usage.
Combinées, ces applications constituent une alternative sécurisée au "Shadow IT", c’est-à-dire à l’utilisation de solutions grand public comme WhatsApp, Telegram, Dropbox ou Wetransfer dans un contexte professionnel.  

 « Grâce à l'expertise de ses membres dans l'édition logicielle, la sécurité des données et les Télécoms, l'entrée au capital de BADGE au sein de Watcha représente un facteur d'accélération majeur pour transformer la start-up en scale-up » a déclaré Xavier Lecomte, CEO de Watcha.

Basée à Lyon, la société compte aujourd’hui 8 collaborateurs et cherche constamment à se renforcer avec de nouveaux talents. Cette levée de fonds va permettre à la start-up d’accélérer son développement commercial et d’élargir sa gamme d’applications, pour construire le futur leader des solutions de collaboration sécurisées.
 

 
 
 
 
 

A propos des Business Angels des Grandes Écoles (BADGE) :

 

Créée en 2004 par des associations d’anciens élèves des Grandes Ecoles, l'association les Business Angels des Grandes Ecoles, devenue un des 1ers réseaux de Business Angels en France, est ouverte à toute personne ayant l’expérience professionnelle et la capacité financière requise pour devenir Business Angel. Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, ce réseau, ouvert à tout projet innovant sans restriction quand à la formation initiale des porteurs de projet :

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • Noue des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement des jeunes entreprises financées,
  • Facilite la création de groupes de Business Angels.

Ses adhérents, aux expériences professionnelles reconnues, ont en 2019 soutenu 25 entreprises par des apports de capitaux propres à hauteur de 2,5 M€. Depuis 2005, 400 Business Angels des Grandes Ecoles ainsi ont financé 175 entreprises en apportant près de 32 M€ qui, par effet de levier sur d'autres sources de financement, ont généré près de 100 M€ d'apport de capitaux.

 

  En savoir plus : www.business-angels.info
Contact Presse : Paul Leondaridis (Délégué Général)
paul.leondaridis@business-angels.info  -  01 42 22 67 35 Business Angels des Grandes Ecoles (BADGE) 15 rue du Colonel Driant – 75001 Paris   Contact WATCHA :  https://watcha.fr/ ou contact@watcha.fr

 

Loguez vous pour ajouter un commentaire.


 
11
Déc
'19

Lettre d'information Externe - Décembre 2019 N°111

 voir l'en-tête complet fermer l'en-tête

Return-Path: <srs0=fr8h=2a=business-angels.info=secretariat@netanswer.fr>
Received: from mwinf5c20 (mwinf5c20 [10.223.111.70]) by mwinb1604 with LMTPA; Tue, 10 Dec 2019 19:56:09 +0100
X-Sieve: CMU Sieve 2.3
Received: from namail2.netanswer.fr ([91.109.120.29]) by mwinf5c20 with ME id cJw92100i0e926K01Jw9Zy; Tue, 10 Dec 2019 19:56:09 +0100
X-bcc: paristech-forum@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (17)(0011)gggruggvucftvghtrhhoucdtuddrgedufedrudelfedgudduhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghi lhhouhhtmecugedttdenucdnofetkffnkffpifculddujedmnecujfgurhepvffufffhrhfkofggtgfgsegrkeerphehtdejnecuhfhrohhmpefrlhgrthgvfhhorhhmvg cuueetugfigfcuoehsvggtrhgvthgrrhhirghtsegsuhhsihhnvghsshdqrghnghgvlhhsrdhinhhfoheqnecuffhomhgrihhnpegsuhhsihhnvghsshdqrghnghgvlhhs rdhinhhfohenucfkphepledurddutdelrdduvddtrddvledpheegrdefiedrudeljedrgeenucfrrghrrghmpehhvghlohepnhgrmhgrihhlvddrnhgvthgrnhhsfigvrh drfhhrpdhinhgvthepledurddutdelrdduvddtrddvledpmhgrihhlfhhrohhmpehsrhhstdepfhhrkehhpedvrgepsghushhinhgvshhsqdgrnhhgvghlshdrihhnfhho pehsvggtrhgvthgrrhhirghtsehnvghtrghnshifvghrrdhfrhdprhgtphhtthhopehprghrihhsthgvtghhqdhfohhruhhmsehorhgrnhhgvgdrfhhrnecuvehluhhsth gvrhfuihiivgephe
X-me-spamlevel: not-spam
X-ME-Helo: namail2.netanswer.fr
X-ME-IP: 91.109.120.29
X-ME-Entity: ofr
Received: from namx0.netanswer.fr (mx0.netanswer.fr [192.168.201.10]) by namail2.netanswer.fr (Postfix) with ESMTP id 5A6DF4B2099; Tue, 10 Dec 2019 19:56:09 +0100 (CET)
Authentication-Results: namail2.netanswer.fr; dkim=pass reason="1024-bit key; insecure key" header.d=business-angels.info header.i=@business-angels.info header.b=VoyezmiT; dkim-adsp=pass; dkim-atps=neutral
Received: from localhost (inamx1.netanswer.fr [192.168.201.11]) by namx0.netanswer.fr (Postfix) with ESMTP id 4F3B21216D7; Tue, 10 Dec 2019 19:56:09 +0100 (CET)
X-Virus-Scanned: Debian amavisd-new at namx1.netanswer.fr
Received: from namx0.netanswer.fr ([192.168.201.10]) by localhost (namx1.netanswer.fr [192.168.201.11]) (amavisd-new, port 10024) with LMTP id bAuaHbnTK279; Tue, 10 Dec 2019 19:56:06 +0100 (CET)
Received: from hr-ch94-1.reseller.mis.ovh.net (ip4.ip-54-36-197.eu [54.36.197.4]) (using TLSv1.2 with cipher ADH-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mx0.netanswer.fr (Postfix) with ESMTPS id 6DAF31216DA for <contact@paristech-alumni.org>; Tue, 10 Dec 2019 19:56:04 +0100 (CET)
Received: by hr-ch94-1.reseller.mis.ovh.net (Postfix, from userid 10010) id BDCF862256; Tue, 10 Dec 2019 18:59:23 +0000 (UTC)
To: Contact <contact@paristech-alumni.org>
Subject: =?utf-8?Q?Lettre_d'information_Externe_-_D=C3=A9cembre_2019_N=C2=B0111?=
DKIM-Signature: v=1; a=rsa-sha1; q=dns/txt; l=211377; s=acy; t=1576004363; c=relaxed/simple; h=from:to:subject; d=business-angels.info; bh=QHjs/AMBnjt2jfcRzYISYEru3fE=; b=VoyezmiTeuwtwnxlDyljkKdEyoiryFy+ut53IJgkSSGr76DpFBg6OV67fyAE IC4mdJqbJN22DpZPP4Xl41WnhFDbmUzhBZaLElHZ0EK6R3aPeJ3okrBhtg3Y iHTqhBO1lHyfhCSCJ7XXy5+zGhpPM8jw8/IcF21LhgHZe1qj4KU=
Date: Tue, 10 Dec 2019 18:59:13 +0000
From: Plateforme BAdGE <secretariat@business-angels.info>
Reply-To: Plateforme BAdGE <secretariat@business-angels.info>
Message-ID: <NTY4NDEzMgAC5758Y328BAMTU3NjAwNDM2MzI0OTA3@business-angels.info>
X-Mailer: PHPMailer 5.2.19 (https://github.com/PHPMailer/PHPMailer)
MIME-Version: 1.0
Content-Type: multipart/alternative; boundary="b1_808c84275a4e3617a83b1f4dedb97d46"
Content-Transfer-Encoding: 8bit

#message .ReadMsgBody { width: 100%; background-color: #ebebeb;} #message .ExternalClass {width: 100%; background-color: #ebebeb;} #message .ExternalClass,#message .ExternalClass p,#message .ExternalClass span,#message .ExternalClass font,#message .ExternalClass td,#message .ExternalClass div {line-height:100%;} #message a[x-apple-data-detectors]{ color:inherit !important; text-decoration:none !important; font-size:inherit !important; font-family:inherit !important; font-weight:inherit !important; line-height:inherit !important;} #message body {-webkit-text-size-adjust:none; -ms-text-size-adjust:none;} #message body {margin:0; padding:0;} #message .yshortcuts a {border-bottom: none !important;} #message .rnb-del-min-width{ min-width: 0 !important;} #message .templateContainer{ max-width:590px !important; width:auto !important;} #message img[class="rnb-col-3-img"] { max-width:170px;} #message img[class="rnb-col-2-img"] { max-width:264px;} #message img[class="rnb-col-2-img-side-xs"] { max-width:180px;} #message img[class="rnb-col-2-img-side-xl"] { max-width:350px;} #message img[class="rnb-col-1-img"] { max-width:550px;} #message img[class="rnb-header-img"] { max-width:590px;} #message .rnb-force-col p,#message ul,#message ol{margin:0px!important;} #message .rnb-del-min-width p,#message ul,#message ol{margin:0px!important;} #message .rnb-tmpl-width{ width:100%!important;} #message .rnb-social-width{padding-right:15px!important;} #message .rnb-social-align{float:right!important;} #message li{mso-margin-top-alt: 0; mso-margin-bottom-alt: 0;} #message table {mso-table-lspace:0pt; mso-table-rspace:0pt;} #message table,#message tr,#message td {border-collapse: collapse;} #message p,#message a,#message li,#message blockquote {mso-line-height-rule:exactly;} #message .msib-right-img { mso-padding-alt: 0 !important;} #message .content-spacing div {display: list-item; list-style-type: none;} @media only screen and (min-width:590px){ .templateContainer{width:590px !important;} } @media screen and (max-width: 360px){ .rnb-yahoo-width{ width:360px !important;} } @media screen and (max-width: 380px){ .element-img-text{ font-size:24px !important;} #message .element-img-text2{ width:230px !important;} #message .content-img-text-tmpl-6{ font-size:24px !important;} #message .content-img-text2-tmpl-6{ width:220px !important;} } @media screen and (max-width: 480px) { td[class="rnb-container-padding"] { padding-left: 10px !important; padding-right: 10px !important;} #message td.rnb-force-nav { display: inherit;} #message .rnb-social-text-left { width: 100%; text-align: center; margin-bottom: 15px;} #message .rnb-social-text-right { width: 100%; text-align: center;} } @media only screen and (max-width: 600px) { .rnb-text-center {text-align:center !important;} #message td.rnb-force-col { display: block; padding-right: 0 !important; padding-left: 0 !important; width:100%;} #message table.rnb-container { width: 100% !important;} #message table.rnb-btn-col-content { width: 100% !important;} #message table.rnb-col-3 { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px; } #message table.rnb-last-col-3 { float: none !important; width: 100% !important;} #message table.rnb-col-2 { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px; } #message table.rnb-col-2-noborder-onright { float: none !important; width: 100% !important; margin-bottom: 10px; padding-bottom: 10px;} #message table.rnb-col-2-noborder-onleft { float: none !important; width: 100% !important; margin-top: 10px; padding-top: 10px;} #message table.rnb-last-col-2 { float: none !important; width: 100% !important;} #message table.rnb-col-1 { float: none !important; width: 100% !important;} #message img.rnb-col-3-img { width:100% !important;} #message img.rnb-col-2-img { width:100% !important;} #message img.rnb-col-2-img-side-xs { width:100% !important;} #message img.rnb-col-2-img-side-xl { width:100% !important;} #message img.rnb-col-1-img { width:100% !important;} #message img.rnb-header-img { width:100% !important; margin:0 auto;} #message img.rnb-logo-img { width:100% !important;} #message td.rnb-mbl-float-none { float:inherit !important;} #message .img-block-center{text-align:center !important;} #message .logo-img-center { float:inherit !important;} #message .rnb-social-align{margin:0 auto !important; float:inherit !important;} #message .rnb-social-center{display:inline-block;} #message .social-text-spacing{margin-bottom:0px !important; padding-bottom:0px !important;} #message .social-text-spacing2{padding-top:15px !important;} } } #message table{border-spacing: 0;} #message table td {border-collapse: collapse;} }

   
 
 

Lettre d'information Externe Décembre 2019 - N°111

 
 
ÉDITO
 

Notre association créée en novembre 2004 a tout juste 15 ans. A cette occasion, je souhaite rendre hommage à son initiateur et premier Président, François Cherruau. Très impliqué dans l’Entreprenariat et la Création d’Entreprises, Président d’X Création et d’X Entrepreneurs, dans un premier temps il a regroupé moins d’une dizaine de membres, puis 40 jusqu’à la promulgation de la Loi TEPA qui a rapidement fait passer le nombre d’adhérents à plus de 200 membres.

 

La progression de l’association fut rapide avec 5 investissements en 2005 pour un montant de 144 k€. Puis 22 investissements pour plus de 2M€ trois ans plus tard. Clairement, le partage de risque avec l’Etat grâce à la défiscalisation a été très efficace.

15 ans après, notre bilan est respectable : plus de 170 sociétés financées, 145 tours ultérieurs de financement apportés pour leur développement. Des milliers d’heures de travail de nos bénévoles ont rendu cela possible.

Notre action a été reconnue lors de deux belles réunions qui se sont tenues en novembre dernier :

  • Lors de la Plénière Inter-réseaux des Business Angels d’Ile de France au cours de laquelle Paul-François Fournier, Directeur Exécutif de Bpifrance en charge de l’Innovation et Alexandra Dublanche, Présidente de la commission du Développement économique, de l’Emploi et de l’Innovation d’Ile de France ont souligné l’importance des Réseaux de BA pour la création d’Entreprise. Rappelons à ce titre que pour l’octroi de son financement French Tech Seed, Bpifrance souhaite l’entrée au capital « d’Investisseurs Avisés » et compte beaucoup sur notre financement.
  • A l’occasion d’une réunion à l’Ecole Nationale Supérieure de Chimie de Rennes, Franck Zal, Fondateur et Président d’HEMARINA, start-up très prometteuse dans le domaine de la santé a expliqué que rien n’aurait été possible sans le soutien des Business Angels : Finistère Angels et BADGE.

Je vous souhaite bonne lecture de cette lettre avec une très intéressante interview de Philippe Louvel de notre membre associé Plasseraud IP, spécialiste de Propriété Industrielle. Ainsi que de passer de très belles fêtes de Noël et de fin d’année.

Amicalement, Jacques Tamisier Président des Business Angels des Grandes Écoles

 
 
 
 
 
 
 
PROPRIÉTÉ INTELLECTUELLE ET START-UPS
 
 
Philippe Louvel, Associé Plasseraud IP Conseil en Propriété Industrielle / Mandataire Européen
 

Un titre de propriété intellectuelle ("PI"), qu’est-ce que c’est et à quoi ça sert ?

Un titre de propriété intellectuelle peut revêtir plusieurs formes, en fonction du type d’objet que l’on souhaite protéger: un brevet protégera des innovations à caractère technique, alors qu’une marque aura vocation à protéger un signe distinctif, et un dessin et modèle protégera une création esthétique, autrement dit le design du produit.

 

Dans le cas de start-ups, notamment celles à contenu technique/technologique, c’est souvent le brevet qui est l’actif clé.

Ces droits et titres de propriété confèrent à leur propriétaire un droit d’interdire aux autres d’exploiter l’invention, d’utiliser la marque ou de reproduire la création objet de la protection. Ce sont donc des armes qui permettent d’attaquer en justice les copieurs et de faire stopper la contrefaçon par un tribunal. Elles offrent donc un véritable avantage concurrentiel et produisent un effet très dissuasif pour les concurrents qui envisageraient de venir sur votre terrain.

Ces droits constituent par ailleurs un fort outil de négociation et, surtout, rassurent les investisseurs. Un droit de PI c’est en effet un actif de la société qui la valorise (un brevet peut valoir plusieurs millions d’euros), permettent de lever des fonds et de générer des revenus (par exemple grâce à l’octroi de licences).

Enfin, posséder des droits de PI, c’est bénéficier d’un avantage marketing qui crédibilise votre technologie : une technologie protégée par brevet sera perçue comme plus solide qu’une innovation technique qui ne l’est pas.

Q : Pourquoi la protection de sa propriété intellectuelle est-elle particulièrement importante pour une start-up ?

La PI est importante pour toutes les entreprises, mais ça l’est d’autant plus pour les start-ups. Au-delà du potentiel humain des porteurs du projet, ce qui fait la valeur d’une start-up, c’est sa propriété intellectuelle. Au printemps 2017, Mines ParisTech avait conduit une étude pour France Brevets auprès d'un échantillon de 800 start-ups qui a révélé que les start-ups qui protègent leur PI ont trois fois plus de chances de réussir.

C’est un levier que pourraient davantage utiliser les start-ups françaises pour surpasser leurs voisins européens. Par exemple, 23 % des jeunes entreprises en Allemagne détiennent au moins un brevet en phase d'amorçage, contre 15 % en France.
Q : Pouvez-vous nous donner quelques exemples de success stories ?

Voici trois exemples dont le premier, OncoDiag, a été financé par BADGE

 
 
 

Q : Un autre exemple ?

Oui le cas HEMARINA, une autre réussite soutenue par BADGE.

 
 

Spin-off du CNRS et de Sorbonne Université (Paris VI), HEMARINA voit le jour en 2007, en Bretagne. La technologie HEMARINA, unique et brevetée (13 familles de brevets), repose sur la seule hémoglobine naturellement extracellulaire de haut poids moléculaire, fonctionnant sur une large plage de température (de 4°C à 37°C) et ne nécessitant aucun cofacteur pour libérer l'oxygène.

 

Q : Et les marques ?

Il s’agit aussi d’un atout critique, qui, lorsqu’il est bien positionné, accompagne positivement le succès d’une solution technique. On peut déposer non seulement le nom de l’entreprise comme OncoDiag®, mais aussi les produits qu’elle commercialise comme URODIAG® COLODIAG®.

Un autre exemple : Hemarina® a créé une déclinaison de marques pour ses produits dérivés : Hemo2life®, HEMHealing®, HEMOXYCarrier®, HEMOXCell®.

A condition de la renouveler et de l’utiliser, une marque n’a pas de limite de durée, alors qu’un brevet une fois expiré au bout de 20 ans, tombe dans le domaine public.

 

♣ ♣ ♣

 
 
 
 
PROCHAINS RENDEZ-VOUS >>> PRÉSENTATIONS DE PROJETS
 

Réunions mensuelles avec présentation de projets innovants en recherche de fonds

animées par Michel Huet, Secrétaire Général, chargé de l'Instruction.  Adhérents inscrivez-vous. Non-adhérents, demandez votre invitation. 

 
 
Mardi 17 Décembre 2019 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
Mardi 21 Janvier 2020 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris  

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 

Retrouvez nos prochaines dates de réunion en 2020 :

https://business-angels.info/actualites

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
NOS ACTUALITÉS
 
 
 
 
Retour sur la Plénière inter-réseaux du Jeudi 28 novembre 2019
 

Jeudi 28 novembre 2019 à 18h, six réseaux de BA d’Île-de-France se réunissaient à l’Espace Carpeaux de Courbevoie pour la seconde édition de cette Plénière inter-réseaux.

Au préalable, chaque réseau (Angels Santé, Arts et Métiers Business Angels, les Business Angels des Grandes Ecoles, Femmes Business Angels, Paris Business Angels et Val’Angels) avait présenté une start-up susceptible de pitcher en Plénière Deux projets particulièrement porteurs, en recherche de financement, avaient été retenus par les organisateurs et se sont présentés à la centaine de Business Angels réunis ce jour là.

Paul-François Fournier, Directeur Exécutif de Bpifrance en charge de l’Innovation et Alexandra Dublanche, Présidente de la commission du Développement économique, de l’Emploi et de l’Innovation d’Ile de France ont souligné l’importance des Réseaux de Business Angels pour la création d’Entreprise. Charazed Djebbari, Adjointe au Maire, Emploi et développement économique présentait les actions de Courbevoie en matière d’accompagnement des start-up avec le Catalyseur de l’Innovation et de l’entrepreneuriat Paris Ouest La Défense (POLD).

A l’issue des pitchs des sociétés Inex et Pledg, l’organisation inter-réseaux recueillait 380 k€ d’intentions d’investissement parmi les 80 personnes ayant participé au sondage en ligne, dont 250 k€ pour Inex et 130 k€ pour Pledg.

 
 

iNex-Circular, société de services pour l’environnement. Faire des déchets des uns (des industries), la matière première de l’autre (les ressources de leurs voisins).

 

Pledg, nouvelle solution de paiement pour booster les achats en ligne.

 

Ces deux finalistes étaient précédés par l'elevator pitch de Nocode-Solutions start-up hébergée par le Catalyseur de l’Innovation et de l’entrepreneuriat Paris Ouest La Défense (POLD).

 
 
Voir la vidéo de l'événement
 
 
 
 
 
 
 
RÉSEAU & PARTENAIRES
 
 
1ères Rencontres « Les ressources financières au service du développement des territoires »
 

Bpifrance (Paris), 16 décembre 2019

 
Programme & Inscriptions
 
Université d’automne France Angels
 

Strasbourg, 13 et 14 novembre 2019

Quand les réseaux de Business Angels, leurs membres, les membres associés, les acteurs de l’écosystème et les partenaires se rencontrent pour échanger les bonnes pratiques, développer les liens entre les réseaux et les autres acteurs du financement de proximité.

 
En savoir +
 
 
 
 
 
 
NOS DERNIERS CLOSINGS
 
 

BADGE et ses adhérents ont contribué à la plus forte levée (165000€) réalisée auprès de quatre autres réseaux de BA afin de développer OAKBOT, la première machine de fraisage à commande numérique portative au monde pour les charpentiers.

 
Lire le communiqué
 

Belle mobilisation des investisseurs de BADGE pour la 2e levée de fonds Telegrafik ; 13 membres et la SIBA BADGE 2019 investissent 130 k€ pour financer le développement de cette start-up toulousaine, acteur du Smart Care (Silver Economy).

 

Neta, société de Nouvelle Aquitaine qui conçoit, produit et commercialise des solutions d’imagerie innovantes, vient de boucler sa levée auprès de trois réseaux de Business Angels. Les adhérents de BADGE ont contribué à hauteur de 108 k€, le fonds régional NACO abondant les participations des BAs individuels.

 

BADGE accompagne Agripolis Organics depuis sa première augmentation de capital en 2017 et vient de participer à une nouvelle opération. 16 investisseurs individuels de BADGE et la SIBA 2019 ont contribué à hauteur de 123 k€ en actions et 20 k€ en obligations.

 

Agripolis, société innovante est un fournisseur de fermes urbaines produisant des fruits et des légumes locaux et sains, qui organisent la résilience environnementale et économique des villes et proposent des services qui redonnent du sens à l’alimentation. Cette levée de fonds, d’un montant total de 600 k€ comportait deux volets ; une augmentation de capital et l’émission d’obligations convertibles. Elle est destinée à assurer le développement de l’entreprise et notamment le démarrage de ce qui sera la plus grande ferme urbaine en terrasse du monde à la Porte de Versailles à Paris.

 
 
En savoir +
 
 
 
 
 
 
 
NOUVELLES DE NOS START-UP
 
 
 
 

Algentech vient de boucler son investissement en actions convertibles. Un brevet US accordé après une longue procédure permettra de booster son développement.

 
 
 
 

Carole Danancher, fondatrice de Kannelle la start-up soutenue par BADGE, spécialisée dans la création de vidéos d’entreprise à partir d’un smartphone, le powerpoint de demain, assurait cette prestation pour les organisateurs de la Plénière inter-réseaux du 28 novembre 2019.

 
Voir la vidéo
 
 
 

Les Business Angels des Grandes Écoles Siège : 12 rue de Poitiers - 75007 Paris Bureaux : 15 rue du Colonel Driant - 75001 Paris Tel : 01 42 22 67 35 secretariat@business-angels.info

www.business-angels.info

 
 
 
 

>>> COMITÉ DE RÉDACTION Jacques Tamisier, Président Paul Leondaridis, Délégué Général Véronique Dupont [ Adressez votre sujet à la rédaction ]

 
 

Se désabonner" style="">>>> Pour mettre à jour vos informations ou vous désabonner de notre newsletter  <<<

 

Loguez vous pour ajouter un commentaire.


 
15
Nov
'19

Lettre d'information Externe - Novembre 2019 N°110

 
 
 

Lettre d'information Externe Novembre 2019 - N°110

 
 
ÉDITO
 

Merci à toutes les associations d’alumni qui font confiance aux talents de BAdGE !

Les associations d’alumni d’écoles d’ingénieurs et de commerce contribuent largement au succès de nos projets d’accompagnement, en nous offrant des ressources à deux niveaux :

 
  • D’une part grâce à la diversité des compétences de leurs membres nous ayant rejoint.
  • D’autre part parce que chaque école enseigne l’Entreprenariat et nourrit la création de start-ups à travers un incubateur ou un accélérateur, représentant ainsi un vivier de projets de qualité.

En contrepartie, BAdGE offre aux membres des alumni deux axes d’opportunités :

  • Devenir membre de notre réseau dont la mission est d’accompagner le développement des jeunes sociétés innovantes qui feront l’économie et les services de demain,
  • Pour les alumni porteurs de projets recherchant un financement et un accompagnement, BAdGE peut répondre à leur besoin.

A titre d’exemple, ce mois-ci, Nicolas Viard, fortement impliqué dans l’Entreprenariat des anciens de l’Agro nous révèle comment il inclut l’exemple et l’actualité de Badge dans son programme d’accompagnement.

Nos accords de partenariat avec les associations d’Alumni sont donc précieux pour le développement de BAdGE, et nous tenons à ce que ces partenariats soient gagnant-gagnant de part et d‘autre : nous sommes ainsi très reconnaissants vis-à-vis de nos partenaires ayant le plus contribué à nourrir notre équipe et à nous présenter des projets d’avenir.

De même, nous restons à l’écoute de toute suggestion qui pourrait faciliter la promotion de nos actions auprès des associations d’alumni et motiver de nouveaux membres à nous rejoindre !

 

Amicalement, Jacques Tamisier Président des Business Angels des Grandes Écoles

 
 
 
INTERVIEW  Nicolas Viard, correspondant école BADGE
 

Bonjour Nicolas, l’association BAdGE a beaucoup apprécié ta mise en relation entre notre réseau de business angels et les alumni Agro d’AgroParistech et d’UniAgro et nous aimerions mieux comprendre le contexte dans lequel tu as entrepris cette démarche.

 

Dans un premier temps, peux-tu me préciser ton rôle auprès des Agros entrepreneurs ?

Dans un premier temps, peux-tu me préciser ton rôle auprès des Agros entrepreneurs ? Dans mes activités professionnelles au sein d’Agro’Innov, j’accompagne le développement de startups et de projets des filières du vivant, en les aidant dans leur stratégie de communication, en élargissant leur réseau et en les mettant en relation avec des sources de financement adaptées à leurs besoins.

Naturellement j’ai élargi ma contribution au réseau des alumni Agros à travers l’organisation de différents événements associant diplômés et étudiants. Ce fut le cas notamment de l’université d’été du Forum Vitae de septembre dernier dont l’objectif était de créer un événement médiatique offrant aux entreprises d’une part, de la visibilité, et aux élèves d’autre part, des sources d’inspiration pour s’approprier leurs sujets de l’année.

On a abordé le parcours du start-uppeur à travers 3 tableaux : enjeux humains, enjeux de marché, et financements. Sur ce volet du financement, cela m’a semblé logique de faire connaître le réseau BAdGE aux alumni, déjà entrepreneurs ou non. Pour BAdGE l’objectif était de convaincre les entrepreneurs et les alumni potentiels investisseurs ! Les vidéos de la soirée sont sur la chaine YouTube AgroParisTech Alumni 

Pourquoi t’être intéressé à BAdGE en matière de financement pour les alumni d’AgroParistech ?

Tout d’abord, le groupe Agro Business Angels existait avant que je ne m’en occupe, mais il était en veille depuis quelques années. J’ai pour ambition de relancer l’intérêt des alumni Agros pour l’investissement ou le financement de projets par BAdGE.

Le réseau Agro Business Angels regroupe près de 300 Agros qui sont intéressés à la fois par la newsletter de BAdGE et par les thèmes de ses soirées. Après, en fonction de leur implication personnelle vis-à-vis du sujet du financement, ils peuvent adhérer ou non aux différentes options de l’association. Ils seront aussi les premiers à recommander BAdGE à leur propre réseau.
Comment sensibilises-tu les alumni Agro à l’intérêt que peut représenter BAdGE ?

Tout d’abord je travaille à identifier les actions du réseau, ce qui me sert de support pour leur démontrer que BAdGE peut être levier d’accélération de leur développement. Lorsque des startuppers de l’Agro viennent me voir pour des sujets de financement de leur projet, je les oriente sur le site de BAdGE, et les invite à consulter les newsletters ainsi que les thèmes des soirées.

Pour les alumni, le fait d’intégrer Agro BAdGE, c’est vraiment une façon de se tenir au courant. La majorité des membres d’Agro BAdGE provient des réseaux Agro Entrepreneurs et Agro Dirigeants, donc surtout des personnes dans la quarantaine qui envisagent d’investir, mais aussi des personnes autour de la trentaine, simplement ouvertes et curieuses ou potentiellement à la recherche de financements pour leur propre structure innovante. Finalement, tu connectes BAdGE avec deux populations d’Agros : d’une part des investisseurs et business angels potentiels, d’autre part des porteurs de projets qui pourraient être financés par BAdGE. En repensant à ces deux cas de figure, quels conseils donnerais-tu à BAdGE au vu de tes premières expériences avec l’association, pour optimiser ses chances de succès auprès des membres alumni Agro ?

Les alumni Agro sont très sensibles aux messages véhiculés sur les réseaux sociaux : une présence de BAdGE sur les réseaux sociaux, tant pour témoigner de la valeur des projets accompagnés que des compétences apportées par les membres de BAdGE, permettrait de renforcer efficacement sa visibilité.

 
 
PROCHAINS RENDEZ-VOUS - PRÉSENTATIONS DE PROJETS -
 

Réunions mensuelles avec présentation de projets innovants en recherche de fonds

>>> Adhérents inscrivez-vous >>> Non-adhérents, demandez votre invitation <<< Par Michel Huet, Secrétaire Général, chargé de l'Instruction  

 
 
Mardi 19 Novembre 2019 à 17h30
 

>>> Exceptionnellement cette réunion se tiendra :

Maison des Ponts - Ponts Alumni 42, rue Boissière - 75116 Paris  

Réunion suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
Mardi 17 Décembre 2019 à 17h30
 

Le Centorial - Campus EDHEC Alumni de Paris 18, rue du Quatre-Septembre - 75002 Paris

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
 
 
 
 
 

Adhésion valable jusqu’à fin 2020

 
 
 
 
 
 
 
NOS ACTUALITÉS
 
 
 
 
Bpifrance Inno Génération : retour en 2 minutes sur le plus grand rassemblement business d’Europe
 

BAdGE était à nouveau présent sur la cinquième édition Bpifrance Inno Génération qui en une seule journée a rassemblé 52.000 entrepreneurs et créateurs d’entreprise à l’Accor Arena Paris-Bercy.

 
 
 
 

Installé sur la Place des Rendez-vous, espace rencontres business dédié aux Business Angels, BAdGE a accueilli 42 porteurs de projets en recherche de financement.
Jacques Tamisier, Président, et Paul Leondaridis, Délégué Général, remercient Paul Bruma, Vice Président, et son équipe Sourcing renforcée pour l’occasion par les membres de BAdGE d’avoir accueilli et renseigné ces entrepreneurs innovants sur la capacité de BAdGE à enregistrer, étudier, soutenir, financer leurs projets. Merci à : Francine Caspari, Christian Delaroche, Gilles Drouard, Isabelle Goudchaux, Jean-Pierre Lacroux, Philippe Pernot, Viviane Moreau,
La journée s’est clôturée par le discours du Président de la République, Emmanuel Macron, accueilli par Nicolas Dufourcq, Directeur Général de Bpifrance >>> retrouvez-les ici
Ainsi que les nombreux autres intervenants et sujets abordés >>> voir ici

 
 
ÉVÉNEMENT
 
 
 
 
 
 
 
Jeudi 28 Novembre 2019 à 18h00
 

Espace Carpeaux

15 Bd Aristide Briand - 92400 Courbevoie

 

Angels Santé, Arts et Métiers Business Angels, les Business Angels des Grandes Ecoles, Femmes Business Angels, Paris Business Angels et Val’Angels réunissent leurs investisseurs pour leur présenter trois opportunités de financement en phase de closing. 400 Business Angels sont attendus pour cette occasion spéciale.

L’objectif de cette plénière inter-réseaux est de réunir en une soirée les intentions d’investissement nécessaires au financement de ces trois startups.

La première édition de cet événement, organisée en mai 2018, a réuni plus de 200 investisseurs au théâtre de Neuilly-sur-Seine. Les montants investis à l’issue de la soirée représentaient plus de 80% des fonds recherchés par les startups, soit plus de 700 000€. Un beau succès !

 

La participation à cette soirée est réservée aux Business Angels des réseaux participants. Venez nombreux et invitez vos amis intéressés / Entrée gratuite mais inscription obligatoire. Informations complémentaires ici et inscription ci-dessous avant le mardi 26 novembre

 
 
S'inscrire
 
 
 
 
 
 
RÉSEAU & PARTENAIRES
 
 
Université d’automne France Angels
 

A Strasbourg les mercredi 13 et jeudi 14 novembre 2019 Les Universités France Angels sont l’occasion pour les réseaux de Business Angels, leurs membres, les membres associés ainsi que les partenaires de se rencontrer, rencontrer les acteurs de l’écosystème, échanger les bonnes pratiques et développer les liens entre les réseaux et les autres acteurs du financement de proximité.

 
S'inscrire
 
SATT Paris-Saclay, déjà 5 ans d’existence !
 

19 novembre 2019 à 18h30 - HEC Jouy-en-Josas Découvrez la SATT Paris-Saclay deeptech factory !

 
S'inscrire
 

LU DANS LA PRESSE

 
 

Point Fiscalité : 25% de réduction d'impôt, encore partie remise !

  Il semblerait que le taux de réduction de l’impôt sur le revenu des personnes physiques ayant investi dans des startup innovantes demeure inchangé à 18% en 2019 malgré l'inscription pour la 2ème année consécutive dans la Loi des Finances du taux de 25%. A nouveau Bercy reporte sur Bruxelles ses propres manquements. Nous aurons droit au taux de 25% en 2020 c'est promis ! Pour Badge, une seule certitude : le moteur de l'investissement ne doit pas être l'avantage fiscal mais la qualité du projet et de l'équipe qui le porte. 

 
En savoir +
 
 
 
 
 

Poitiers. La société Seekyo et l’équipe de recherche de Sébastien Papot ont breveté un anticancéreux. Les résultats exaltent les espoirs de la médecine. 

 
En savoir +
 
 
 
 
 

Kinvent, la sportech qui muscle la rééducation fonctionnelle. Localisée à Montpellier, la jeune société innovante a mis au point un outil de suivi, de planification et d'individualisation des entraînements, dédié aux préparateurs physiques, entraîneurs et kinésithérapeutes. Pour accélérer sa R&D, Kinvent vient de boucler un financement de 1 million d'euros.

 
En savoir +
 
 
 
 
 
 
NOS DERNIERS CLOSINGS
 
 

Le graphène est un matériau découvert en 2004, c'est le matériau le plus conducteur, le plus solide, le plus imperméable et possède bien d'autres propriétés encore. Après 4 années de R&D, Graphene Production a mis au point une méthode de production révolutionnaire de graphène, il est devenu le plus gros producteur européen. Graphene Production a débuté une levée de fonds pour asseoir son statut de plus gros producteur européen et accélérer son développement commercial. Le volet Equity vient d'être finalisé. Les Business Angels des Grandes Ecoles sont fiers d'avoir participé pour moitié à cette augmentation de capital, Arts et Métiers Business Angels, Angels Bay Invest, Femmes Business Angels et des investisseurs Auvergne-Rhône-Alpes Angels complétant le tour de table.

 

Comme annoncé dans notre dernière Lettre d’information, Vetbiobank premier laboratoire vétérinaire français à exploiter le pouvoir des cellules souches néonatales pour traiter les maladies inflammatoires chroniques des animaux dont l'arthrose canine et équine, vient de boucler une levée de fonds de 1.020 K€. BAdGE et ses adhérents ont contribué à cette levée.

 
Lire le communiqué
 
 
 
 
 
 
NOUVELLES DE NOS START-UP
 
 
 
 

Des solutions Otono-me connectées pour aider les personnes âgées à rester autonomes à la maison, en EPHAD ou en Résidence. Ces solutions pour le bien vieillir sont basées sur une technologie d’analyse de données et une algorithmie de pointe qui permet de détecter les mouvements anormaux de la personne surveillée à partir de capteurs installés sur son lieu de vie. Telegrafik a levé 1m€ en janvier 2017 pour mettre sur le marché Otono-me domicile. A ce jour, Telegrafik est sur le point de réaliser une 2ème augmentation de capital pour accélérer l'acquisition de clients finaux et réussir le lancement de ses nouvelles offres.

Carole Zisa-Garat, Présidente de Télégrafik, invitée d’Europe1 présente l’offre de solutions connectées aux personnes âgées vivant à domicile, en résidence Séniors ou en EHPAD.

 
Voir le replay
 
 
 
 

BAdGE le plus gros réseau de BA à financer Cardiawave s’associe au succès de cette entreprise prometteuse qui vient de réaliser une première mondiale en traitant de manière non-invasive avec des ultrasons thérapeutiques des patients atteints de rétrécissement aortique calcifié .

 
Lire le communiqué
 
 
 

Les Business Angels des Grandes Écoles Siège : 12 r. de Poitiers 75007 Paris Bureaux : 15 r. du Colonel Driant 75001 Paris Tel : 01 42 22 67 35 secretariat@business-angels.info

www.business-angels.info

 
 
 
 

>>> Suivez l’actualité du réseau en vous abonnant à cette Newsletter ICI <<<

 
 

>>> COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général / Véronique Dupont Adressez votre sujet à la rédaction: secretariat@business-angels.info

Se désabonner" style="text-decoration: underline; color: rgb(255, 255, 255);">>>> Pour mettre à jour vos informations ou vous désabonner de notre newsletter  <<<

 

 

Loguez vous pour ajouter un commentaire.


 
22
Oct
'19

Lettre d'information Externe - Octobre 2019 N°109

 
 
 

Lettre d'information Externe Octobre 2019 - N°109

 
 
ÉDITO
 

Quelles conséquences de l’arrêt de la défiscalisation de l’ISF pour les investissements PME ?

Le dernier rapport de France Invest pour 2018 présente quelques enseignements intéressants : le capital investissement s’est élevé à 18,7 Mds€ en hausse de 13% par rapport à 2017.

 

Cependant, si on regarde seulement les financements par origine géographique, on s’aperçoit que les financements français ont diminué fortement de 11,3 Mds € à 9,7 Mds €, les financements étrangers passant de 5,2 Mds€ à 9 Mds€.

Pour l’instant, il ne semble pas qu’il y ait eu en 2018 de diminutions des fonds investis par les Business Angels. C’est l’analyse que fait France Angels. France Invest note également une progression des fonds investis par les Investisseurs privés et les Family Office (non différenciés dans l’étude). Mais cela va-t-il durer ?

Sans les financements par les BAs, des sociétés au fort potentiel n’existeraient pas et nous en avons des exemples dans notre portefeuille. De nouvelles mesures d’incitation fiscale (comme celles qui existent dans les principaux pays européens) dynamiseraient fortement ces investissements avec un délai de retour sur investissement de moins de 2 ans, pour les finances de l’état.

C’est le sens de la proposition faite par France Angels en réponse à la consultation du gouvernement sur le Pacte productif 2025, demandant un taux de déduction IRPP porté de 18% à 50% avec un plafond de déduction spécifique de 100.000 € par part fiscale, en cas de souscription au capital des PME innovantes.

Espérons que notre message sera entendu.
Amicalement,
Jacques Tamisier Président des Business Angels des Grandes Écoles

 
 
 
INTERVIEW  Catherine Mineur, nouvelle adhérente BADGE
 

Diplômée de Neoma Business School, j'ai plus de quinze années d'expérience professionnelle dans le secteur bancaire en France et aux Etats-Unis. J'ai occupé des fonctions de direction financière et de directrice de projets stratégiques de transformation. 

 

Ayant vécu et travaillé quatre années à New York, j'y ai découvert l'importance de s'enrichir de rencontres et découvertes au delà de sa "zone de confort". J'ai ainsi animé le réseau des alumni de Neoma à New York en créant des évènements autour de présentations de sociétés, d'alumni ou de rencontres avec d'autres réseaux d'écoles.

Rentrée en France, j'ai eu à cœur de garder cette dynamique et curiosité. J'ai découvert BADGE en Juin dernier lors d' une réunion de présentations de projets communiquée sur l'agenda de Neoma Alumni. J'ai été enthousiasmée par la qualité de l'organisation et des présentations ainsi que la pertinence des questions d'un auditoire restant bienveillant. En m'entretenant avec Paul Leondaridis, celà a tout de suite conforté mon impression qu'au sein de BADGE, l'activité d' investissement bénéficie d'une approche structurée et pluridisciplinaire permettent de couvrir une grande palette de projets et secteurs. Le fait que BADGE offre à ses adhérents des formations permet aussi de maintenir la qualité future du sourcing et instructions de projets.

Devenue adhérente, je souhaite m'engager dans le sourcing de projets, assister aux "pitchs" et détecter des projets pouvant être porteurs pour les membres de BADGE. J'envisage plus tard également d'instruire un projet et investir. C'est une formidable façon de soutenir la dynamique entrepreneuriale française , prendre des risques et par là même acquérir des expériences d'accompagnement de sociétés dans leur développement via les participations aux comités stratégiques.

 
 
PROCHAINS RENDEZ-VOUS - PRÉSENTATIONS DE PROJETS -
 

Réunions mensuelles avec présentation de projets innovants en recherche de fonds

>>> Adhérents inscrivez-vous >>> Non-adhérents, demandez votre invitation<<< Par Michel Huet, Secrétaire Général, chargé de l'Instruction  

 
 
Mardi 15 Octobre 2019 à 17h30
 

Le Centorial - Campus EDHEC de Paris 18 rue du 4 Septembre - 75002 Paris

Réunion en salle Tokyo suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
Mardi 19 Novembre 2019 à 17h30
 

Exceptionnellement à la Maison des Ponts

42 rue Boissière - 75116 Paris  

Réunion suivie d’un cocktail. Inscription obligatoire, se munir d’une pièce d’identité.

 
S'inscrire
 
 
 
 
 
 
 
 
 
 
 

MIEUX CONNAITRE, COMPRENDRE L’ACTIVITÉ DE BADGE

 
Voir le rapport annuel 2018
 
 
 
 
 
 
NOS ACTUALITÉS
 
 
 
 
24 septembre 2019 : Une rentrée exceptionnelle avec près de 50 participants pour la 1ère réunion de présentation de projets qui se tenait dans les locaux du Campus EDHEC.
 

Jacques Tamisier, Président de BADGE ouvrait la séance, suivi de Michel Huet, Secrétaire Général en charge de l’Instruction qui lors d’un tour d’horizon, présentait l’ensemble des dossiers en cours. Un très bon accueil à la fois de la part de l’équipe EDHEC Alumni qui met la salle à disposition, et de la part des membres de BADGE à la découverte de nouveaux projets dans lesquels investir. Les participants, investisseurs potentiels, étaient ravis de poursuivre la discussion avec les porteurs de projets lors du cocktail, ce moment de networking qui clôture nos réunions mensuelles

 
 
 
 
03 octobre 2019 : Le Grand Pitch
 

Le 3 octobre 2019 se tenait à Paris, l’événement inter-réseaux organisé par Paris Business Angels ; 12 pépites, 12 pitchs de 3 minutes et 1 application pour noter les projets en direct.

 
 
 
 
10 octobre 2019 : Venez nous rencontrer sur le plus grand rassemblement business d’Europe – BIG à Paris
 

BADGE participera à l’événement Inno Génération organisé par Bpifrance à Paris – Bercy Accor Arena. L'occasion de venir échanger avec notre équipe, découvrir BADGE et nous parler de vos projets. 

 
Obtenir mon invitation
 
 
 
 
Venez retrouver BADGE le 24 octobre à l’ESCP Europe, à l’Edtech Investor Day, Paris
 

Edtech Investor Day est organisé par HEADway Advisory, cabinet de conseil dédié à l’enseignement supérieur. Cet événement parisien se déroulera Jeudi 24 octobre 2019, de 8h30 à 19h30 sur le campus parisien de l’ESCP Europe.

Les 3 parties prenantes du marché de la Edtech seront réunies sur un même lieu autour de tables-rondes sessions de pitch rencontres, démos, réunions business et networking avec : 

  • Plus de 25 start-up spécialisées dans les technologies de l’éducation,
  • Des établissements d’enseignement supérieur,
  • Des investisseurs.
 
Informations, programme et inscription
 
 

Inscriptions et tarif préférentiel Business Angels pour nos adhérents > demandez votre code promo à secretariat@business-angels.info

 
 
SAVE THE DATE Séance plénière inter-réseaux BA IDF
 
 
Jeudi 28 Novembre 2019 à 18h00
 

Espace Carpeaux

15 Bd Aristide Briand - 92400 Courbevoie

 

Après le succès de la 1ère réunion de mai 2018 à Neuilly, renouvellement de l’initiative commune de 7 réseaux de BA d’Ile de France avec l’organisation d’une plénière inter-réseaux où seront présentés 3 projets à financer.

La participation à cette soirée est réservée aux Business Angel des réseaux participants. Informations complémentaires et inscription avant le mardi 26 novembre.

 
 
S'inscrire
 
 
 
 
 
 
NOS DERNIERS CLOSINGS
 
 

VetBioBank est le premier laboratoire vétérinaire français à exploiter le pouvoir des cellules souches néonatales pour traiter les maladies inflammatoires chroniques des animaux dont l'arthrose canine et équine. Ainsi ce 1er laboratoire de médecine régénérative vétérinaire avec ses thérapeutiques de nouvelle génération peut redonner une seconde vie à nos compagnons (chevaux, chiens, chats).

 

Chouette Copro bouleverse les relations entre copropriétaires, syndic et prestataires techniques, en simplifiant radicalement la gestion quotidienne des parties communes de l’immeuble. Cette plateforme collaborative aide à la résolution des problèmes de l’immeuble en mettant en relation directe les habitants, leur syndic et les prestataires techniques. Grâce à son appli collaborative qui facilite le quotidien, Chouettecopro permet à chacun de signaler rapidement un incident technique à partir d’une photo, d’un message. L’ensemble des habitants connectés peut suivre en direct les étapes de la résolution de l’incident en un clic depuis un smartphone, une tablette ou un ordinateur. Un diagnostic facilité, une résolution plus rapide par des prestataires techniques garantissant la satisfaction générale des habitants!

 
En savoir +
 
 
 
 
 
 
NOUVELLES DE NOS START-UP
 
 
 
 

Progression spectaculaire pour le nouvel investissement BADGE, avec la société KINVENT qui a signé des accords de distribution en Chine, au Brésil et au Chili, préparant par ailleurs son entrée sur le marché américain. KINVENT est depuis peu le partenaire officiel du renommé « Montpellier Hérault rugby » présidé par Mohed Altrad. Le staff technique du club espagnol de football FCBarcelona a lui aussi choisi KINVENT biomécanique pour la préparation physique et la réadaptation de ses joueurs de renommée mondiale.

 
En savoir +
 
 
 

Les Business Angels des Grandes Écoles Siège : 12 r. de Poitiers 75007 Paris Bureaux : 15 r. du Colonel Driant 75001 Paris Tel : 01 42 22 67 35 secretariat@business-angels.info

www.business-angels.info

 
 
 
 

COMITÉ DE RÉDACTION Jacques Tamisier, Président / Paul Leondaridis, Délégué Général / Véronique Dupont Adressez votre sujet à la rédaction: secretariat@business-angels.info

>>> Pour mettre à jour vos informations ou vous désabonner de notre newsletter  <<<

 

Loguez vous pour ajouter un commentaire.


 
18
Sept
'19

Communiqué de presse_BADGE et le RNIB signent une convention de partenariat

 
 
 
COMMUNIQUÉ DE PRESSE
 
 
 
Les Business Angels des Grandes Ecoles (BADGE) et le Réseau National des Incubateurs de Barreau (RNIB) signent une convention de partenariat
 

Paris, le 10/09/2019 - Les Business Angels des Grandes Ecoles (BADGE) et le Réseau National des Incubateurs de Barreau (RNIB) ont identifié leur potentiel de complémentarité en direction des startups et viennent de signer une convention de partenariat dont les objectifs sont les suivants :

  • Le RNIB invitera BADGE aux présentations des LegalTech incubés par ses membres,
  • Lorsque BADGE sera directement contacté par des startups ayant des projets de société dans le domaine « LegalTech » recherchant un incubateur, il les orientera vers le RNIB,
  • BADGE apportera son expertise de Business Angels au RNIB dans la sélection et l’accompagnement des startups,
  • Les Legaltech incubées par les membres du RNIB et sélectionnées par le RNIB en raison de leur potentiel prometteur pourront rechercher auprès des adhérents de BADGE le financement nécessaires à leur levée de fonds,
  • Les Avocats qui souhaiteraient devenir Business Angels seront invités aux réunions mensuelles de présentation de projets.
 
 

"Nous sommes très heureux de la signature de ce partenariat. Nous pensons que cela peut alimenter de façon très positive notre sourcing d’entreprises à financer dans le domaine LegalTech qui est un domaine en forte croissante et nous souhaitons que de nombreux avocats rejoignent notre association car ils apporteront une expertise très complémentaire à celle que nous avons déjà" a déclaré Jacques Tamisier, Président de BADGE.

"Nous nous félicitons également de la signature de ce partenariat. Le financement des LegalTech incubées par nos membres est un enjeu majeur pour leur développement. La grande expérience de BADGE dans le financement des startups sera un atout de qualité pour le RNIB, nos membres et les LegalTech qu’ils accompagnent. Nous espérons également que de nombreux avocats adhéreront à BADGE, aussi bien pour apporter leur expertise que pour stimuler l’investissement auprès des LegalTech soutenues par notre réseau" a déclaré Mélanie Parnot, co-Présidente du RNIB.

 
 
 
 
 

A propos des Business Angels des Grandes Écoles

 

Créée en 2004 par des associations d’anciens élèves des Grandes Ecoles, l'association les Business Angels des Grandes Ecoles, devenue un des 1ers réseaux de Business Angels en France, est ouverte à toute personne ayant l’expérience professionnelle et la capacité financière requise pour devenir Business Angel. Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, ce réseau, ouvert à tout projet innovant sans restriction quand à la formation initiale des porteurs de projet :

  • met en relation les entrepreneurs avec les Business Angels investisseurs,
  • noue des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • apporte soutien méthodologique et formation aux Business Angels
  • organise l'accompagnement des jeunes entreprises financées,
  • facilite la création de groupes de Business Angels.

Ses adhérents, aux expériences professionnelles reconnues, ont en 2018 soutenu 21 entreprises par des apports de capitaux propres à hauteur de 3.3 M€. Depuis 2005, 400 Business Angels des Grandes Ecoles ainsi ont financé 160 entreprises en apportant 30 M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 90 M€ d'apport de capitaux.

 

Pour en savoir plus : www.business-angels.info
Pour nous contacter : dg@business-angels.info  /  01 42 22 67 35

15 rue du Colonel Driant – 75001 Paris

 
 
 
 

A propos du Réseau National des Incubateurs de Barreaux

 

Créé à l’initiative du Barreau de Paris en octobre 2017 et constitué en association loi 1901 en novembre 2018, le Réseau National des Incubateurs a pour vocation de fédérer les Incubateurs des Barreaux de France en vue de faire émerger une réflexion commune sur l’enjeu axial de la transformation numérique de la profession d’Avocat et devenir ainsi un acteur incontournable des décideurs publics ou privés. Ce faisant, le RNIB entend contribuer à la pérennité de la profession d’avocat en l’aidant à s’approprier l’outil numérique et à le maîtriser dans le respect de nos règles déontologiques, par un accompagnement opérationnel des projets aussi bien que par une action prospective. Rejoint depuis par de nombreux Barreaux déjà dotés d’un Incubateur (Aix-en-Provence, Bordeaux, Grasse, Grenoble, Hauts de Seine, Lyon, Marseille, Montpellier, Nîmes, Paris, Rennes, Strasbourg), le RNIB se propose par ailleurs d’aider les Barreaux qui n’en ont pas à créer leur propre incubateur pour soutenir la mise en place de projets innovants portés par des entrepreneurs avocats, destinés à leurs cabinets ou à leurs clientèles.

 

Pour en savoir plus : www.rnib.fr (disponible fin septembre 2019)
Pour nous contacter : contact@rnib.fr  / 06 79 88 05 40

16 rue Régale – 30000 NIMES

 

 

Loguez vous pour ajouter un commentaire.


 
15
Juil
'19

Communique de presse_Jacques Tamisier elu President de BADGE_17 juin 2019

Communiqué de presse

 

 

 

Paris, le 24 juin 2019 

 

 

 

Jacques Tamisier élu Président de BADGE, 

par "Les Business Angels des Grandes Ecoles"

A l’issue de l’Assemblée Générale Ordinaire des Business Angels des Grandes Ecoles (BADGE) du 17 juin 2019, Jacques Tamisier membre de l’association depuis dix ans, et depuis cette année élu au Comité Exécutif de France Angels, Fédération Française des réseaux de Business Angels, succède à Henri Jannet à la présidence de BADGE. 

Jacques TamisierJacques Tamisier adhère en 2009 à l’Association des Business Angels de l’X devenue BADGE, « Les Business Angels des Grandes Ecoles ».

Après avoir réalisé l’ensemble de sa carrière dans le Groupe France Télécom/Orange, alternant entre des postes situés en France et à l’étranger (Etats Unis, Argentine et Espagne) il est sensibilisé à l’impact des technologies numériques et des innovations disruptives qui ont créé de nouvelles tendances de consommation et de services. 

Convaincu que les métiers de demain seraient créés en particulier par de Jeunes Entreprises Innovantes, il sait que les Business Angels ont un rôle à jouer, et décide d’investir avec BADGE afin d’aider des startups à se développer.

Investisseur dans une quinzaine de projets créateurs d’emploi, portés par des entreprises qui, au total ont recruté 150 à 200 personnes, depuis son adhésion, Jacques Tamisier a été successivement en charge de l’Instruction de projets et Représentant de BADGE au Comité Stratégique de plusieurs entreprises investies.

Impliqué dans le développement des entreprises qu’il suit par ses conseils et son engagement au service des actionnaires de BADGE, il est également membre du Comité Exécutif de France Angels, la Fédération Française des réseaux de BAs.

En tant que Président nouvellement élu, il entend capitaliser sur la reconnaissance professionnelle de BADGE, tant par les porteurs de projets qui nous sollicitent, que par les investisseurs attirés par la qualité des projets proposés et animer notre association pour : 

  • Faire croître le nombre de nos membres,  
  • Augmenter notre niveau d’investissement,
  • Développer le sourcing des dossiers en particulier dans le domaine de la Deep Tech,
  • Mettre un focus particulier sur les sorties pour les dossiers financés depuis plus de 5 ans,
  • Contribuer aux actions de France Angels pour que les Business Angels soient reconnus comme maillon indispensable dans l’écosystème de la création d’entreprises.

    Les membres du Bureau et du Conseil d’Administration:
    Retrouvez-les sur : business-angels.info
 Jacques Tamisier  Michel Huet
I. Reulier
 HJannet

Jacques Tamisier
Président, Administrateur de France Angels

 

Michel Huet
Secrétaire Général, Chargé de l’Instruction des dossiers

 

Isabelle Reulier
Trésorière

 

Henri Jannet, Vice Président Président SIBA BADGE 2015

 

 BRUMA Paul2 carre francoisleve   jfm7  Catherine Delcroix2 2019

Paul Bruma
 
Vice Président,
En charge du Sourcing

 

François Levé
Vice Président, En charge des Comités de validation et de sélection

 

Jean-François Macquin
Vice Président. En charge du SIG et des relations écoles d’ingénieurs.
Président SIBA BADGE 2017

 

Catherine Delcroix
Vice Présidente. En charge de l’Accompagnement et sorties.
Présidente SIBA BADGE 2019

 


Le Conseil d’Administration :

Delaroche Christian2 Desplat2   ANDG  HOUZE Christian 2carre  1 2 Paul Leondaridis

Christian Delaroche

 

 

Jean-François Desplat 

 

 

Anne-Sophie de Gabriac
Relations Grandes écoles de management

Christian Houze

 

 

Paul Leondaridis,
Délégué Général

 

Pernot Philippe2  shallal VAILLANT Gilles2 carre   yolin

 

Philippe Pernot

 

 

Audra Shallal

 

 

Gilles Vaillant

 

 

Jean-Michel Yolin,
Relations AX et Ministère des Finances et de l’Industrie
 

 

 

 

                                                                                                                    
A propos de BADGE : www.business-angels.info

Créée en 2004 par des associations d’anciens élèves des Grandes Ecoles, l'association les Business Angels des Grandes Ecoles, devenue un des 1ers réseaux de Business Angels en France, est ouverte à toute personne ayant l’expérience professionnelle et la capacité financière requise pour devenir Business Angel.
Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement.

Pour cela, ce réseau :

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • Noue des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement de ces jeunes entreprises,
  • Facilite la création de groupes de Business Angels notamment dans les associations d'anciens élèves des Grandes Ecoles.

Ses adhérents, aux expériences professionnelles reconnues, ont participé en 2018 à 21 levées de fonds, apportant 3.3 M€ à des entreprises.
Depuis 2005, les Business Angels des Grandes Ecoles ainsi ont financé 160 entreprises en apportant 30,2 M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 90 M€ d'apport de Capitaux dans les entreprises.


Contact presse :
Paul Leondaridis, Délégué Général - 06 07 05 59 59 - paul.leondaridis@business-angels.com

Télécharger le communiqué de presse:

RETROUVONS-NOUS SUR LES RESEAUX : LinkedIn Twitter Site Internet 

 Les Business Angels des Grandes Ecoles 

Tel : 01 42 22 67 35 
secretariat@business-angels.info 
www.business-angels.info

Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
28
Mai
'19

0705_Lettre d'information externe mai 2019 N°105

          Lettre d'information externe Mai 2019 - N°105

Nos événements

Nouveau site web

Soyez curieux, découvrez-le : 
https://business-angels.info/

Le 17 avril dernier BADGE a mis en ligne son nouveau site public, revu avec des fonctionnalités améliorées, une meilleure visibilité sur son activité, les raisons d’intégrer ou de se maintenir dans notre réseau, 1er réseau de BA de France Angels en 2018 par le montant apporté aux start-ups : 3,3M€. 

Il est désormais possible d’adhérer en ligne : j'adhère!

------------------------------------------------------------------

 Suivez nos réunions en streaming

Vous ne pouvez venir sur place ou vous libérer pour assister à la réunion mensuelle de présentation de projets ?  Pour un suivi en direct et à distance  par nos adhérents, le streaming va être réactivé.

La connexion à la salle "BADGE plénière"
est 
libre d'accès avec ce lien: http://bpifrance.adobeconnect.com/rf3dktowajw1/

Cliquez sur le lien, inscrivez-vous en tant que Participant avec votre NOM et Prénom. N’hésitez pas à intervenir à poser vos questions via le chat de la session.

Rendez-vous pour le 1er streaming,
 Mardi 21 mai à 17h30 pour la réunion mensuelle, présentation de projets.

------------------------------------------------------------------ 

 EuroQuity logo

EuroQuity est la plateforme européenne de Bpifrance, de mise en relation de  entre entreprises et investisseurs. Elle fonctionne comme un réseau social.

Adhérents, investisseurs potentiels, créez votre profil, suivez et rejoignez BADGE.

Vous serez identifiés en tant que BA ou fonds et disposerez d'outils performants pour suivre l'actualité des entreprises innovantes en recherche d'invesstisseurs.

Porteurs de projets, start-ups, pour développer visibilité et crédibilité, demandez le Label BADGE.

   Logo Bpifrance

PRESENTATIONS DE PROJETS

Mardi 21 Mai 2019 à 17h30
Par Michel Huet, responsable de l'Instruction.

Maison des X - (salon Aigle)
12, rue de Poitiers - 75007 Paris
Réunion suivie d'un cocktail 
Pour vous inscrire : cliquez ici
secretariat@business-angels.info

 Mardi 11 Juin 2019 à 17h30

Par Michel Huet, responsable de l'Instruction.

AgroParisTech Alumni - Grande salle
5, quai Voltaire - 75007 Paris
Réunion suivie d'un cocktail 
Pour vous inscrire: cliquez ici 
secretariat@business-angels.info

Formation Instruction
Cette formation est fortement recommandée aux nouveaux instructeurs et à ceux qui souhaitent instruire un projet, par Michel Huet, Vice-Président en charge de l'Instruction

Mardi 14 Mai de 14h00 à 17h00
Maison des X (salon Aigle)
12, rue de Poitiers - 75007 Paris

Pour vous inscrire: cliquez ici 
secretariat@business-angels.info

Guy Gourevitch, 
nouveau président de France Angels
logoFranceAngels 

Guy Gourevitch a succédé à Tanguy de la Fouchardière à l'issue de l'AG annuelle. Le bureau de BADGE le félicite chaleureusement pour son éléction à la présidence de notre fédération.
Jacques Tamisier, Vice-Président de BADGE  a été élu administrateur. Il sera en charge des projets deep tech.

France Angels est la Fédération nationale des Business Angels. Elle travaille au développement d’un environnement économique, social et juridique favorable aux Business Angels et agit pour promouvoir leur rôle d’accompagnateurs et de financeurs de jeunes entreprises à fort potentiel de croissance, créatrices d’emplois.

En savoir plus : Site France Angels

Nouvelles de nos start-ups

  •  cardiawave 
    Fondée en 2016 par Benjamin Bertrand et soutenue par BADGE avec 1,4M€ en deux levées de fonds, obtient l'autorisation d'essais cliniques pour le 1er traitement non-invasif au monde du rétrécissement aortique calcifié.
    Suite du communiqué de presse ici : 
  • Legaltech :Predictice
    Predictice financée par nos adhérents à hauteur de 136K€ en 2017 remporte le Grand Prix du Sommet des start-ups, organisé en mars 2019 par le magazine Challenges.

     

  • Tech& IOT : 
    La start-up lancée par Olivier Jeannel en 2014, lui-même sourd, est une application et une plateforme permettant aux malentendants de téléphoner. Avec 746K€ investis par nos adhérents depuis 2016, RogerVoice a bouclé sa sa 3ème levée de fonds, dont près de la moitié investie par BADGE. 

    Retrouvez-la dans la saison 2 du documentaire hashtag#FoundationTheDoc, la série en immersion chez Station F montrant le quotidien de 3 start-ups dont Rogervoice : https://lnkd.in/gDwgB7Z

  • Retrouvez  Logo Geokaps sur le salon VivaTech, stand J09 123, pour le rendez-vous incontournable de l’innovation digitale, du 16 au 18 mai 2019 à ParisExpo - Porte de Versailles. Plus d'information : https://vivatechnology.com/ 

SUIVEZ-NOUS : 

nos actualites

Edito du Président

 

Une SIBA pour ici-bas

Vous pouvez espérer trouver, par un investissement en direct, la start up qui vous enverra au septième ciel en rendant au centuple la somme investie. L'équipe au sein des Business Angels des Grandes Ecoles chargé de dénicher cette pépite, la perspicacité des membres du Comité de sélection, la qualité de l'instruction  sont là pour vous y aider.

Vous pouvez aussi dans un vision plus terre à terre, avec un investissement modeste,  vouloir diversifier votre portefeuille de start up. Les sociétés d'investissement de Business Angels (SIBA) sont conçues pour cela. Notre réseau lance sa sixième SIBA, Badge 2019, réservée à nos adhérents. Une SIBA est une société Holding, aux frais de fonctionnement réduits, qui investit dans des sociétés dans lesquelles les adhérents des Business Angels des Grandes Ecoles ont eux-mêmes investi en direct. La période de souscription est ouverte.

Si vous êtes intéressé, adhérez et souscrivez !

Amicalement,
Henri Jannet

OncoDiag élue start-up de l'année
par les adhérents de BADGE 

OncoDiag Claude Hennion

 

 

 
Claude Hennion, Président d'OncoDiag
Entretien réalisé par Isabelle Goudchaux

Bonjour Claude, vous avez été élu entreprise de l’année par les membres de BADGE qui ont été séduits par le projet que vous menez avec OncoDiag. Pouvez-vous rapidement me rappeler ce que propose OncoDiag et les raisons qui vous ont orienté dans cette direction ?

OncoDiag développe de nouveaux tests non invasifs de dépistage, de diagnostic et de suivi de cancer. Ces tests sont destinés à faciliter une prise en charge précoce du cancer en évitant certains examens invasifs et pénibles. Ils permettent également une réduction significative des coûts. Le premier test développé concerne le suivi du cancer de la vessie (cancer à très fort taux de récidive). Le deuxième test, en cours de développement, concerne le dépistage et le diagnostic du cancer colorectal. L’enjeu est le dépistage systématique de ce cancer.

Dans quel contexte les Business Angels ont-ils offert une réponse adaptée à vos besoins de financements extérieurs ?

Le développement de ces tests nécessite une validation sur une large cohorte de patients. Les besoins financiers associés, inférieurs au million d’euros, sont compatibles avec les possibilités de financement par plusieurs groupes de Business Angels (BADGE, Angels Santé, Normandie Business Angels). Le financement ainsi obtenu a été complété par des aides.

L’association de ces 3 groupes a permis de réaliser assez rapidement les diligences nécessaires à la levée de fonds.

Si vous deviez décrire en quelques mots-clés ce que vous avez retenu de votre collaboration avec BADGE, qu’est-ce qui vous vient à l’esprit ?
Le premier mot qui me vient à l’esprit est Fédérateur. La capacité de l’association à fédérer trois importants groupes de Business Angels a permis de réunir les fonds que nous recherchions, à savoir 600 000 euros. Et au-delà de cet aspect essentiel, la complémentarité des membres de ces trois groupes nous a donné accès à un vaste réseau de personnalités qui nous ont conseillé et orienté dans la recherche de subventions, de partenaires, de cliniciens ainsi que de contacts pour une éventuelle sortie future.

Ensuite en repensant à Badge, je pense Qualité d’écoute et Bienveillance. Nous avons fortement apprécié la capacité de nos interlocuteurs à comprendre notre projet et ses enjeux, ainsi que leur bienveillance manifestée lors des petites difficultés rencontrées telles que retards ou modification de planning.

Si BADGE devait faire des efforts pour s’améliorer sur un aspect en particulier, quelle serait votre recommandation ?

Naturellement, après chaque présentation, nous sommes très impatients de savoir si notre projet a plu et a des chances d’être financé. Le système de décision de BADGE est relativement complexe et donc un peu long, mais c’est aussi une façon de permettre à un maximum de membres de bien connaitre les projets et de se familiariser avec leurs porteurs. 

Logo Seekyo 

Un espoir qui a séduit nos Business-Angels

SEEKYO® est une société dédiée à réduire les effets secondaires des traitements contre le cancer en développant un arsenal de vecteurs thérapeutiques. Nous avons tous des proches confrontés à ces terribles problèmes : un espoir se dessine, et, très vite, nos Business-Angels se sont proposés pour soutenir cette jeune start-up dans l’aventure !

La chimiothérapie conventionnelle présente peu de sélectivité vis-à-vis des cellules tumorales et s’attaquent également aux tissus sains provoquant des effets secondaires.
Afin de palier à cela, SEEKYO® élabore des vecteurs thérapeutiques aux propriétés uniques, véhiculant un médicament vers son site d’action grâce à un vecteur non-toxique puis régénérant son activité anticancéreuse sélectivement au niveau de la tumeur.
Les recherches du Professeur Sébastien Papot l’on conduit à mettre au point une « plateforme » composée de trois fonctions chimiques distinctes permettant d’assembler facilement les différentes unités du vecteur thérapeutique.Seekyo plateforme moleculaireLes résultats obtenus sur des modèles de cancers humains (cancer du sein, du cou et du pancréas) testés sur des souris, sont probants et robustes. L’étude pré-clinique non réglementaire commencera en juin. Elle est rendue possible grâce à l'apport en capital des Business Angels.Les résultats obtenus sur des modèles de cancers humains (cancer du sein, du cou et du pancréas) testés sur des souris, sont probants et robustes. L’étude pré-clinique non réglementaire commencera en juin. Elle est rendue possible grâce à l'apport en capital des Business Angels.

Il reste encore un très long chemin à parcourir pour confirmer ces résultats sur l’humain et élaborer des médicaments. Nos Business-Angels sont prêts à prendre des risques au coté des entrepreneurs!
SEEKYO® a été présenté à notre réunion mensuelle du 16 avril, par le Pr. Sébastien Papot et Oury Chetboun, CEO. La somme de 70 k€ allouée à BADGE a été souscrite en moins de 48 heures !

Un beau succès inattendu, dont la conséquence est que plusieurs de nos membres n’ont pas pu être servis. Nous espérons que les études du Pr Sébastien Papot évolueront favorablement et que d'autres Business Angels pourrons rejoindre l'aventure dès la prochaine levée de fonds prévue en 2020.

10

Créée en 2004, l'association les Business Angels des Grandes Ecoles, devenue un des 1ers réseaux de Business Angels en France, est ouverte à toute personne ayant l'expérience professionnelle et la capacité financière requise pour devenir Business Angel.

Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, ce réseau :

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • Noue des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement de ces jeunes entreprises,
  • Facilite la création de groupes de Business Angels notamment dans les associations d'anciens élèves des Grandes Ecoles

Ses adhérents, aux expériences professionnelles reconnues, ont participé en 2018 à 21 levées de fonds, apportant 3.3 M€ à des entreprises.
Depuis 2005, les Business Angels des Grandes Ecoles ainsi ont financé 160 entreprises en apportant 30 M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 90 M€ d'apport de Capitaux dans les entreprises

Les Business Angels des Grandes Ecoles
Tel : 01 42 22 67 35
secretariat@business-angels.info
www.business-angels.info

partenaires

COMITÉ DE RÉDACTION :
Henri Jannet, Président / Paul Leondaridis, Délégué Général / Véronique Dupont

Adressez votre sujet à la rédaction: secretariat@business-angels.info

Se désabonner

Loguez vous pour ajouter un commentaire.


 
08
Avril
'19

Lettre d'information externe avril 2019 N°104

          Lettre d'information externe Avril 2019 - N°104

Nos événements

Retour en images sur l'événement annuel exceptionnel organisé à Paris par le Réseau des Business Angels des Grandes Ecoles.

20190320 181655 2     X Apolinaski SATT
20mars2019 Badge ODDO

Public
Reunion BADGE ODDO20190320C. Lacroix F. Leve J. Tamisier PL Oddo 20 mars 2019

Plus de 100 participants se sont retrouvés  le 20 mars 2019 chez ODDO BHF Banque Privée  pour  la réunion annuelle de BADGE.

Après l’accueil par Jean-Philippe Taslé d’Héliand, Président ODDO BHF Banque Privée et le rappel des actions menées par cette dernière en matière de financement de projets innovants, 

Xavier Apolinarski Président de SATT Paris-Saclay a présenté le programme national French Tech Seed.

Henri Jannet, Président de BADGE est revenu sur cette dense année 2018 avec 1000 entreprises rencontrées par une équipe engagée conduisant  à 132 projets examinés en Comité de validation et à 21 investissements par nos adhérents.

Rappelant le véritable rôle du Business Angel et les 5 métiers qu’il incarne, il invitait les 9 start-ups financées en 1er tour en 2018 par les adhérents BADGE, à témoigner de leurs relations et de l’apport des Business Angels dans leur développement.

ENALEES - Laurent Thiery
KAZOART - Mathilde Le Roy
KANNELLE - Carole Danancher
PHONOPTICS - Vivien Staehle
SHAPEHEART - Antoine Schwoob
HEALSY - Stéphane Bidet
ONCODIAG - Claude Hennion
TICTACTRIP – Hugo Bazin
GEOKAPS – Hélène Lucien

Une interview a été réalisée après les pitchs en avec la technologie innovante de KANNELLE voir la vidéo

A l'issue des pitch un sondage en ligne a été organisé pour élire la start-up de l'année.
Le vainqueur a été ONCODIAG. Nous souhaitons beaucoup de réussite à Claude Hennion et son équipe dans leur projet.

Logo Oncodiag

PRESENTATIONS DE PROJETS

Mardi 16 Avril 2019 à 17h30
Par Michel Huet, responsable de l'Instruction.

12, rue de Poitiers - 75007 Paris
Réunion suivie d'un cocktail (salon Aigle)
Pour vous inscrire: cliquez ici
secretariat@business-angels.info

Mardi 21 Mai 2019 à 17h30
Par Michel Huet, responsable de l'Instruction.
12, rue de Poitiers - 75007 Paris
Réunion suivie d'un cocktail (salon Aigle)
Pour vous inscrire : cliquez ici
secretariat@business-angels.info

Mardi 11 Juin 2019 à 17h30
Par Michel Huet, responsable de l'Instruction.

AgroParisTech Alumni - Grande salle
5, quai Voltaire - 75007 Paris
Pour vous inscrire: cliquez ici 
secretariat@business-angels.info

Formation Instruction
Cette formation est fortement recommandée aux nouveaux instructeurs et à ceux qui souhaitent instruire un projet, par Michel Huet, Vice-Président en charge de l'Instruction

Mardi 14 Mai de 14h00 à 17h00
Maison des X (salon Aigle)
12, rue de Poitiers - 75007 Paris

L'Université de Printemps France AngelslogoFranceAngels 

Franc succès pour l'Université de Printemps FRANCE ANGELS qui a réuni  les 26 et 27 Mars 2019 les principales fédérations de l'Hexagone  au Siège de BPI France.

Guy Gourevitch a succédé à Tanguy de la Fouchardière à l'issue de l'AG annuelle. Jacques Tamisier a été élu administrateur.

Retrouvez le Bilan annuel de France Angels : Investissements des BA en 2018

SUIVEZ-NOUS :
 

 
nos actualites

Edito du Président

 

Tant qu’on a la santé !

Cet adage populaire résume bien l’impression qui se dégage de l’analyse des 21 sociétés financées par les Business Angels des Grandes Ecoles en 2018. 

Les quatre sociétés du secteur de la santé ont récupéré à elles seules la moitié des sommes levées!

Cet attrait des investisseurs pour les dossiers «santé» n’est pas étranger aux bons résultats de 2018, où la somme record de  3.3 M€ a été apportée par nos adhérents.

Nous avons organisé le 20 mars dernier, dans les locaux de la Banque Oddo, la présentation des 9 sociétés financées pour la première fois par les Business Angels des Grandes Ecoles en 2018.  Deux  d’entre elles, Oncodiag et Healsy,  interviennent dans le domaine de la santé.  Les participants présents ont pu voter pour choisir parmi ces 9 sociétés celles  qui  les avaient le plus séduits. Oncodiag a été élue la start-up de l’année 2018.  Cette société développe des solutions innovantes pour le diagnostic précoce des cancers. Sur le podium on trouve aussi  Healsy  qui propose le premier service mobile de prédiction de la glycémie capable de s’adapter à la physiologie et aux habitudes de chaque patient.

Dans un contexte fiscal peu encourageant pour le financement de l’amorçage, heureusement qu’on a la santé !

Amicalement,
Henri Jannet

Une femme de talent : Carole Danancher,
Co-fondatrice de KANNELLE
Entretien réalisé par Isabelle Goudchaux

Carole
Kannelle

Bonjour Carole, pouvez-vous nous préciser en quoi votre solution est innovante et vos ambitions avec ce projet?

Kannelle est la seule solution vidéo offrant la possibilité à n’importe quel collaborateur de réaliser des vidéos engageantes, professionnelles et chartées en 15 minutes seulement depuis son smartphone. A ce jour, nos clients restent des entreprises françaises, mais nous avons plusieurs contacts très prometteurs à l’étranger pour un développement rapide à l‘international.

A quel moment avez-vous eu besoin de financements extérieurs pour votre développement, et pourquoi avez-vous choisi BADGE ?
La recherche de financement est intervenue après le lancement commercial de Kannelle. Nous avions déjà 5 clients actifs lors de la prise de contact avec le réseau BADGE.
Nous en avons aujourd’hui une quinzaine. La preuve de concept étant réalisée, nous avions besoin de financement principalement pour pouvoir recruter, à la fois des profils tech et des commerciaux.

Ce qui nous a agréablement surpris chez BADGE, c’est la qualité et la complémentarité des profils de ses membres : le mix de profils ingénieurs et business a permis une étude et une compréhension de notre projet dans tous ses aspects.

Finalement, quel a été le rôle de BADGE dans votre développement à ce jour ?

À la fois une réponse efficace à notre besoin de financement car l’instruction a été relativement rapide, et une dimension encourageante par la bienveillance avec laquelle cette instruction a été menée. Et surtout le réseau BADGE nous a apporté près de 170k€ de souscriptions, avec lesquels nous avons déjà pu recruter 2 développeurs informatique ainsi qu’un business développer junior et une stagiaire sur la partie commerciale. Par ailleurs, la crédibilité du réseau BADGE nous a permis d’activer rapidement d’autres réseaux de Business Angels en complément.

Voyez-vous des aspects du fonctionnement de BADGE sur lesquels le réseau pourrait être encore plus efficace ?

Le premier point de contact avec BADGE n’est pas évident. Contrairement à la plupart des réseaux de Business Angels qui utilisent la plateforme Gust1, BADGE dispose de sa propre plateforme, ce qui force le porteur de projet à dupliquer sa candidature pour le réseau. 
Le temps étant compté et l’issue incertaine à ce stade, certains porteurs de projets peuvent être découragés de soumettre leur projet au réseau BADGE.
Le réseau BADGE pourrait davantage communiquer à l’égard des start-ups, notamment sur ses valeurs ajoutées vis-à-vis des autres réseaux : capacité à effectuer une instruction rapide, capacité à fédérer d’autres réseaux autour de BADGE, ouverture quant au fait de partager les points clés de l’instruction, etc.


 1 : Gust est une société US avec des données stockées aux US.Pour des raisons de confidentialité des données, BADGE a choisi de développer sa propre plateforme sécurisée.

Le family buy out facilité

OPTION FINANCE - 14 JANVIER 2019
HERVÉ PICHARD ET BRUNO PICHARD, PICHARD ET ASSOCIÉSPichard HervePichard Bruno

Dans le cadre des débats et des controverses actuels, on aurait pu craindre des tentatives de remise en cause ou de limitations des pactes Dutreil qui facilitent les transmissions d’entreprise. Il n’en a rien été. Au contraire, l’article 40 de la loi de finances pour 2019 assouplit les conditions d’application de ces pactes, tant sur les obligations de fond, (avec par exemple un abaissement des seuils de détention en droits financiers, les seuils en droit de vote demeurant inchangés) que sur les obligations de forme (avec la suppression de l’attestation annuelle à adresser au service des impôts compétent pour confirmer que les conditions d’application des pactes sont bien satisfaites) .

Lire la suite en ligne :

ON EN PARLE DANS LA PRESSE

 4 start-up financées par nos adhérents en 2018 figurent dans le top 100 des start-up où investir Magazine Challenges 28 mars 2019 :

  1. Tech & IOT : Orosound, premiers écouteurs à annulation de bruit sélective pour les 84% de personnes gênées par le bruit en open-space.
  2. Biotech & santé : Healsy, premier service mobile de prédiction de la glycémie capable de s'adapter à la physiologie et aux habitudes de chaque patient.
  3. Services et commerce: KAZoART leader en France dans la vente d’art en ligne, d'artistes à amateurs d'art.
  4. et Predictice remporte le Grand Prix du Sommet des start-up, organisé par le magazine Challenges

Si vous ne l'avez encore fait, rejoignez-nous!
business angel
 

10

Créée en 2004, l'association les Business Angels des Grandes Ecoles, devenue un des 1ers réseaux de Business Angels en France, est ouverte à toute personne ayant l'expérience professionnelle et la capacité financière requise pour devenir Business Angel.

Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, ce réseau :

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • Noue des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement de ces jeunes entreprises,
  • Facilite la création de groupes de Business Angels notamment dans les associations d'anciens élèves des Grandes Ecoles

Ses adhérents, aux expériences professionnelles reconnues, ont participé en 2018 à 21 levées de fonds, apportant 3.3 M€ à des entreprises.
Depuis 2005, les Business Angels des Grandes Ecoles ainsi ont financé 160 entreprises en apportant 27 M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 90 M€ d'apport de Capitaux dans les entreprises

Les Business Angels des Grandes Ecoles
Tel : 01 42 22 67 35
secretariat@business-angels.info
www.business-angels.info

partenaires

COMITÉ DE RÉDACTION : Henri Jannet, Président / Paul Leondaridis, Délégué Général
Adressez votre sujet à la rédaction: secretariat@business-angels.info

Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
18
Mars
'19

Lettre d'information externe mars 2019 N°103

         Lettre d'information externe mars 2019 - N°103

 

 Les Business Angels des Grandes Ecoles organisent un événement exceptionnel 

MERCREDI 20 MARS 2019 de 18h à 20h

 dans les locaux de la Banque Privée ODDO BHF

12, boulevard de la Madeleine Paris 9e

Adhérents, parlez-en à vos amis intéressés par l'activité des Business Angels, ils sont les bienvenus 

Inscrivez-vous!

 PROGRAMME

18h00 : Accueil des invités 

18h15 : Ouverture par la Banque Privée ODDO HBF 
et Henri JannetPrésident des Business Angels des Grandes Ecoles.

18 h 20 : Invités d’honneur Xavier ApolinarskiPrésident,
et Michael FournierDirecteur Général Adjoint, SATT Paris-Saclay.

Présentation du programme national French Tech Seed, 
de la labellisation comme apporteur d'affaires du consortium fédéré par la SATT Paris-Saclay.   

18h35 : Présentation des Business Angels des Grandes Ecoles 
par
 Henri Jannet, Président.

18h45 – 19h30 : Témoignages de 9 start-up financées en 2018 en 1er tour par nos adhérents

19h30 : Cocktail d'échanges

NOS ÉVÉNEMENTS

PRÉSENTATION DE PROJETS

Mardi 19 Mars 2019 à 17h30 réunion plénière : présentation de projets instruits

AgroParis Tech Alumni
5 quai Voltaire 75007 Paris
Grande Salle

Par Michel Huet, secrétaire général, responsable de l'Instruction.

Pour vous inscrire: cliquez ici
Inscriptions: secretariat@business-angels.info

La start-up Pragma Industries a créé la sensation au salon CES de l’innovation de Las Vegas avec son invention qui pourrait bouleverser le marché mondial des deux-roues.

Logo Pragma
« Toutes les personnes qui l’ont essayée dans les allées du salon avaient le sourire et revenaient complètement bluffées par les capacités de notre machine », explique Pierre Forté, créateur de Pragma Industries et inventeur d’un vélo nouvelle génération qui a reçu un prix, l’Innovation Award, au CES de Las Vegas.
Cet ancien ingénieur dans l’aéronautique militaire a imaginé le concept il y a une quinzaine d’années. « J’ai tout de suite été persuadé que l’hydrogène était potentiellement un vecteur énergétique propre. Ensuite, il a fallu concrétiser le concept car travailler l’hydrogène n’est pas une chose facile », ajoute-t-il.

Le concept repose sur une pile à hydrogène permettant une autonomie de 10 km et un temps de recharge inférieur à la minute, là ou les vélos électriques traditionnels ont besoin de trois ou quatre heures pour refaire le plein.
« Nous avons bricolé avec nos petites mains dans la cuisine pendant des mois et des mois, puis dans mon garage. Et puis un jour, on s’est dit là ça commence vraiment à ressembler à ce que l’on veut », se souvient Pierre Forté. Désormais, Pragma Industries dispose d’un grand local doté d’un laboratoire de chimie et d’un banc d’essai.

Formation

Spéciale nouveau adhérents

Mardi 02 Avril à 15h00

Thème : l'activité de Business Angel
par Henri Jannet

Présentation du "métier" de Business Angel et des outils mis à disposition par le réseau (dont le site internet)

Maison des X, 12 rue de Poitiers 75007
Salon Aigle

Pour vous inscrire: cliquez ici

UNIVERSITE DE PRINTEMPS 

 

UNIVERSITÉ DE PRINTEMPS PARIS 

26 & 27 MARS 2019

L'UNIVERSITÉ DE PRINTEMPS DE FRANCE ANGELS SE TIENDRA CETTE ANNÉE LES 26 & 27 AVRIL2019 AU

SIÈGE DE BPI FRANCE
(6-8 BOULEVARD HAUSSMANN)

IMPACT²
Jeudi 28 mars 2019 à 18h
Hôtel de Ville de Paris
INSCRIPTIONS:
  
 
SUIVEZ-NOUS SUR LES RÉSEAUX SOCIAUX
 

Suivez-nous sur linkedin : 
Les BAs des Grandes Ecoles

Suivez-nous sur twitter : @BAGrandesEcoles

nos actualites

Edito du Président


Notre ambition pour les  start up de la « Deep Tech »  du Plateau de Saclay !

Un fonds d'investissement d'amorçage doté de 400 M€ et dédié aux  projets industriels avec de futures usines fabricant en « dur » (Deep Tech) vient d'être mis en place par le Premier Ministre. Ce fonds est géré par la BPI.

L'originalité de la démarche  provient du mode de sélection des projets qui doivent être apportés par des consortia labelisés. Celui constitué autour de la SATT Paris Saclay  fédère 9 grands acteurs de l'entreprenariat du Plateau de Saclay (notamment issus  des Grandes Ecoles AgroParisTech, Centrale, HEC , et Polytechnique) et les réseaux de Business Angels d'ile de France dont, bien sûr, les Business Angels des Grandes Ecoles. Ce consortium vient d'être officiellement labellisé comme apporteur d'affaires.

Devenir un acteur important du financement privé de ces start up à coté de ce financement public est notre ambition.

Lors de notre grande manifestation du 20 mars prochain dans les locaux de la Banque Oddo, nous aurons l'occasion d'en savoir plus. Venez nombreux et invitez vos amis et relations intéressés par cette activité de Business Angel.

Amicalement,

Henri Jannet

La French Tech Seed
un fond doté de 400 M€ en faveur de l'innovation


 

Annoncé par le premier ministre Edouard Philippe en juin 2018 comme instrument de la politique nationale d’innovation, le nouveau fond French Tech Seed voit officiellement le jour ce jeudi 17 janvier 2019. Doté de 400 millions d’euros issus du PIA 3 et géré par Bpifrance, ce fond a vocation à soutenir les start-up technologiques en phase de post-maturation, notamment des start-up DeepTech de moins de 3 ans.

Sa spécificité : il repose sur un mécanisme d’apporteurs d’affaires labellisés et un effet de levier sur l’investissement privé – un euro d’investissement privé pouvant donner droit à un co-financement de deux euros de Bpifrance, sous forme d’obligations convertibles.»

Les apporteurs d’affaire au cœur du French Tech Seed

L’originalité du fond French Tech Seed repose donc sur ce mécanisme d’apporteurs d’affaires labellisés. Ces structures de confiance, réunies en consortium, sont la clé de voûte du mécanisme French Tech Seed et ont vocation à :

  • Qualifier les projets de création d’entreprise innovantes à forte intensité technologique
  • Garantir le caractère innovant et technologique des projets présentés
  • Suivre et accompagner les entreprises sélectionnées pour booster leur plan stratégique, leur développement commercial et leur recherche de financements
  • Mobiliser leur écosystème de financeurs privés qui apporteront la contrepartie de financement privé requise à côté de l’investissement du fond French Tech Seed.

Labellisation inédite d’un consortium piloté par la SATT Paris-Saclay en tant qu’apporteur d’affaires

Le consortium fédéré autour de la SATT Paris Saclay, composé de neuf membres issus de l’écosystème Paris-Saclay (la filière entrepreneuriale d’AgroParisTech, CentraleSupélec, l’accélérateur de l’École Polytechnique, Genopole, la filière entrepreneuriale d’HEC, IncubAlliance, l’Institut d’Optique Graduate School et le WAI Massy-Saclay de BNP Paribas), vient d’être labellisé apporteur d’affaires par le fonds French Tech Seed opéré par Bpifrance. L’objectif de ce consortium : fédérer les forces vives de la maturation technologique, de l’incubation de start-up et de l’accélération d’entreprises de l’écosystème Paris-Saclay afin de renforcer la création et l’accélération de start-up technologiques.

Les Business Angels des Grandes Ecoles sont partnenaires financeurs de ce consortium nouvellement labéllisé. 

Baromètre des Business Angels

Barometre

France Angels et BFM Business publient pour la 7ème fois le « Baromètre des Business Angels ». L’objet de ce baromètre est de donner une tendance de l’évolution de l’activité des Business Angels. Une première série de questions ont été posées aux responsables des réseaux. Elles concernent l’année 2018 passée, et une deuxième série les interroge sur la vision de l’année 2019. Pour compléter ce baromètre et le positionner dans l’environnement actuel, deux questions d’actualité ont été posées aux Business Angels, membres des réseaux.

Enquête réalisée entre le 28/01/2019 et le 15/02/2019.

Lire la suite en ligne

Rejoignez nous !
COTISATION 2019
 
2019
 
Comme lors de chaque début d'année et dans un souci de bon fonctionnement de notre association, renouveller votre adhésion .

Nous rappelons nos trois formules :
 
"adhérent découverte" réservée aux nouveaux adhérents qui veulent découvrir l'activité du Réseau sans intention d'investir
 
"Adhérent actif" destinée aux adhérents qui veulent bénéficier de la totalité des services rendus par le réseau et investir si des projets les séduisent
 
"Adhérent de suivi" destinée aux adhérents qui ont construit leur portefeuille de start up et qui ont décidé d'arrêter d'investir.
 
Les Business Angels des Grandes Ecoles vous remercient de votre confiance.

10

Créée en 2004, l'association les Business Angels des Grandes Ecoles est un des 1ers réseaux de Business Angels en France.

Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, le réseau des Business Angels des Grandes Ecoles,

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • Noue des relations avec les principaux incubateurs et accélérateurs, notamment ceuxcréés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement de ces jeunes entreprises,
  • Facilite la création de groupes de Business Angels dans les associations d'anciens élèves des Grandes Ecoles.

Ses adhérents, aux expériences professionnelles reconnues, ont participé en 2018 à 22 levées de fonds, apportant 3.4 M€ à des entreprises.
Depuis 2005, les Business Angels des Grandes Ecoles ainsi ont financé 160 entreprises en apportant 28 M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 90 M€ d'apport de Capitaux dans les entreprises

Les Business Angels des Grandes Ecoles
Tel : 01.42.22.67.35
secretariat@business-angels.info
www.business-angels.info

partenaires
 

COMITÉ DE RÉDACTION : Henri Jannet, Président / Paul Leondaridis
Adressez votre sujet à la rédaction: secretariat@business-angels.info

Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
14
Janv
'19

Lettre d'information externe Janvier 2019 - n°100

        Lettre d'information externe Janvier 2019 N°100

Les Business Angels des Grandes Ecoles vous souhaite une Bonne Année 2019 
Nos événements 

PRÉSENTATION DE PROJETS

Prochaines réunion mensuelle publique de présentation de projets :

Le Mardi 5 Février 2019 à 17h30

Le Mardi 19 Mars 2019 à 17h30 

à La Maison des X

12 rue de Poitiers 75007 Paris

En salon Aigle 

Pour vous inscrire : cliquez ici

FORMATIONS 

Mardi  26 Mars à 17h30 pour la formation «Nouveaux arrivants»

Salles à confirmer

Pour vous inscrire : cliquez ici 

 

PaulL

Le billet du Délégué Général

 

Les grands progrès de l'humanité sont la conséquence d'idées innovantes qui ont été mises en œuvre et abouti. Ces idées engendrées par la pensée créatrice de l'homme aux limites encore inconnues ont été diffusées, puis adoptées. Avec des nouveaux outils les nouvelles idées ont permit d'engendrer de nouvelles innovations, d'amélioration ou de rupture.

Aujourd'hui avec Internet la diffusion est quasi instantanée et pluridirectionnelle. C'est tout le paradoxe du progrès, trop d'information tue l'information. Alors le travail du Délégué Général de BAdGE consiste à organiser, à trier, à classer les projets détectés, déposés et amenés par les différents canaux dont le principal demeure notre notoriété. Une fois dans le workflow il faut organiser le suivi avec nos adhérents et les membres du bureau le long des différentes étapes du projet. Ma priorité est d'améliorer les processus déjà bien rodés en mettant l'accent sur l'accompagnement des projets investis par nos membres, jusqu'à la sortie des BAs.

Cette tâche devrait occuper une part croissante de nos ressources : notre portefeuille de sociétés investies augmente ainsi que leur ancienneté moyenne. Je m'emploierai avec le support du Président et du Bureau à poursuivre le rayonnement de notre association.

Pour mon arrivée au poste de Délégué Général et à l'aube de la nouvelle Année 2019 je souhaite de belles sorties aux anciens investisseurs, des moments excitants avec nos start-up aux nouveaux et des coups de cœur pleins d'espoir à ceux qui nous rejoignent maintenant.

Paul Leondaridis

 
 SUIVEZ-NOUS SUR LES RÉSEAUX SOCIAUX
 

Suivez-nous sur linkedin :
Les BAs des Grandes Ecoles

Suivez-nous sur twitter : @BAGrandesEcoles

 
 
Edito du Président

Présents !

Les adhérents des Business Angels des Grandes Ecoles (Badge)  ont répondu en 2018  largement  « présents »  aux  nouvelles levées de fonds des entreprises dans lesquelles ils avaient déjà investi.

L’année 2018 est un record avec 3.4 M€ apportés par nos adhérents à 22 entreprises innovantes.  

Ce résultat remarquable provient principalement d’une confiance consolidée des investisseurs vis-à-vis des entreprises dans lesquelles ils avaient déjà investi lors d’une première levée de fonds. En effet, le montant global des investissements dans le cadre de tours ultérieurs en 2018 s’élève à 2,3 M€, montant encore jamais atteint depuis la création de Badge en 2004.

En revanche, la baisse de 30% des financements de nouveaux projets par rapport à l'année précédente est probablement la conséquence de la disparition des crédits d'impôt ISF/IFI.

Pour 2019, je vous adresse mes vœux les plus chaleureux pour vous-même et ceux qui vous sont chers. Je formule aussi le souhait que l’envie d’accompagner des start up innovantes reste le moteur de notre communauté, au-delà d’un contexte fiscal peu favorable.

                                                                                  Amicalement,

                                     Henri Jannet

nos actualites

La parole 

Jacquest

Jacques Tamisier

Bonjour Jacques, vous êtes un membre actif de BADGE, investisseur et même instructeur de plusieurs projets.

Tout d’abord, pouvez-vous me préciser ce qui vous a incité à devenir Business Angel ?

J’ai réalisé l’essentiel de ma carrière dans le Groupe FT/Orange dans des domaines très variés, la technique, le Marketing, la Stratégie et la Finance, toujours sur des sujets à fort contenu en innovation. J’ai ainsi été sensibilisé à l’impact des technologies numériques et de certaines innovations disruptives qui ont créé de nouvelles tendances de consommation et de services qui ont challengé notre modèle économique.  J’en ai acquis la conviction que les métiers de demain seraient créés par les sociétés les plus innovantes et en particulier par de Jeunes Entreprises Innovantes et que les Business Angels avaient un rôle à jouer.   

Par ailleurs j’ai toujours eu une appétence pour le risque et j’ai toujours trouvé plus intéressant de décider dans quelles entreprises investir plutôt que déléguer ce choix à des banques.

L’investissement dans des jeunes sociétés innovantes était donc une suite logique à ces deux constats

Pourquoi avez-vous choisi BADGE comme cadre d’investissement ?

En tant qu’ancien de Polytechnique, j’ai adhéré à l’Association de Business Angels de l’X peu après sa création en 2009. Elle s’est rapidement transformée en Business Angels des Grandes Ecoles, par des accords avec d’autres Grandes Ecoles d’ingénieur ou de management et maintenant nous accueillons aussi toutes les personnes ayant une formation universitaire. Ceci a permis d’une part d’élargir la palette de compétences de ses membres et d’autre part de générer davantage de projets grâce aux relations avec les incubateurs ou accélérateurs de ces Ecoles.

Aujourd’hui, quel bilan feriez-vous de votre expérience avec l’association BADGE ?

Je suis tout d’abord admiratif de l’énergie, de la prise de risque, de l’inventivité des porteurs de projets, toujours sur des projets ambitieux. Certains des projets que nous avons financés auront des retombées importantes sur notre qualité de vie, je pense en particulier à des sociétés dans lesquelles j’ai investi dans le domaine médical.

Grâce à l’instruction de projets, j’ai la chance de représenter Badge au Comité Stratégique de plusieurs entreprises, de me sentir impliqué dans leur développement par mes conseils et mon engagement au service des actionnaires de Badge et j’ai pu nouer des relations d’amitié avec les Porteur de Projet et les autres membres du Comité que je n’aurais jamais eu l’occasion de croiser.

Donc si je comprends bien BADGE vous offre l’opportunité de vivre des expériences humaines enrichissantes et de contribuer concrètement à des projets d’entreprises innovantes. Mais sur le plan financier, qu’en tirez-vous concrètement ?

J’ai investi dans une quinzaine de projets.

Quatre d’entre eux, ceux de la première heure n’ont pas survécu, un a été vendu sans pertes ni profits. Mais depuis, la sélection des entreprises par BADGE s’est considérablement professionnalisée, et aujourd’hui, sept ou huit des projets dans lesquels j’ai investi progressent très bien sur leur roadmap et deux d’entre eux présentent des perspectives exceptionnelles.

C’est aussi une grande satisfaction de savoir que les entreprises dans lesquelles j’ai investi emploient entre 150 et 200 personnes et seront amenées à recruter davantage dans le futur. Sans les Business Angels, une bonne partie de ces entreprises n’existeraient pas…

Pour cette raison, je n’hésite pas à partager mon sentiment qu’être membre de Badge est très gratifiant et j’invite les investisseurs à nous rejoindre pour pouvoir financer encore davantage de projets.

Merci beaucoup Jacques pour votre témoignage !

La parole 

Franckezal
 Franck Zal fondateur et PDG d’Hemarina

Interrogé au sujet de BADGE, Franck Zal, fondateur et PDG d’Hemarina, exprime sa reconnaissance vis-à-vis d’un réseau de compétences toujours disponible et à l’écoute, avec l’intérêt pratique d’un interlocuteur unique.

Bonjour Franck, dans un premier temps pouvez-vous resituer le secteur d’activité d’Hemarina ?

Après avoir travaillé 15 ans au CNRS, j’ai découvert une molécule chez un ver marin qui, pour simplifier, pourrait être l’ancêtre de nos globules rouges.

Hemarina est donc une entreprise du secteur de la biotechnologie, qui a mis au point une  molécule qu’on caractérise comme une plate-forme technologique capable de répondre à toute problématique en lien avec un  besoin d‘oxygène, dans le domaine médical comme dans le domaine industriel.

Pourquoi avez-vous choisi BADGE pour financer le développement de Hemarina ?

Hemarina s’est développé notamment grâce aux Business Angels, regroupés au sein de plusieurs associations. Après avoir commencé avec Finistère Angels, BADGE a été mis en réseau pour financer Hemarina. Ma rencontre avec BADGE s’est faite naturellement, parce que tous les Business Angels se mettaient en réseau et à ce moment-là BADGE était particulièrement focalisé sur des problématiques de santé.

Après un dépôt en ligne j’ai été sollicité pour présenter mon dossier en 2010-2011.

L’association a-t-elle répondu à vos attentes ?

Au-delà de cela même, les Business Angels ont de nombreuses compétences en raison de leurs parcours professionnels, propres à chacun.

Grâce aux business Angels j’ai pu garder le contrôle de ma société. SI j’avais fait entrer des fonds d’investissement, je pense que je ne serais pas là à vous parler.

Chez BADGE tout d’abord, j’ai découvert des gens extrêmement proches de moi, toujours là, toujours à vouloir aider tout en me laissant gérer l’opérationnel et la stratégie. Il y a énormément de respect chez tous les membres de BADGE.

Quand je veux discuter avec nos actionnaires de BADGE je n’ai qu’une personne à contacter, c’est vraiment très pratique. De plus il y a des compétences chez BADGE qu’on ne va peut-être pas trouver dans un autre club de Business Angels.

Ils savent faire confiance et sont des actionnaires de long terme.

Quelles recommandations pourriez-vous faire aux BADGEs pour mieux valoriser leurs compétences au service des entreprises qu’ils accompagnent ?

On fait peu appel aux compétences des actionnaires alors que je suis sûr que leur parcours pourrait aider à débloquer plus vite certaines situations critiques.

Ce qui serait très intéressant à mon sens c’est de savoir, derrière chaque actionnaire que l’on a, quels types de compétences on peut trouver : sous forme d’annuaire, avec des mots clés, dans l’esprit Who’s who.

Autre chose : ils ont parfois du mal à évaluer le potentiel de certains dossiers. Ils devraient solliciter les dirigeants des sociétés dans lesquelles ils ont investi pour les aider à bien investir dans de nouveaux dossiers. Nous on le ferait volontiers. Pour moi ce serait simplement : vous nous avez aidés aujourd’hui on vous aide.

Merci beaucoup, Franck, pour votre spontanéité et votre reconnaissance !

10

Créée en 2004, l'association les Business Angels des Grandes Ecoles est un des 1ers réseaux de Business Angels en France.

Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, le réseau des Business Angels des Grandes Ecoles,

  • Met en relation les entrepreneurs avec les Business Angels investisseurs,
  • A nouer des relations avec les principaux incubateurs et accélérateurs, notamment ceux créés au sein des Grandes Ecoles,
  • Apporte soutien méthodologique et formation aux Business Angels
  • Organise l'accompagnement de ces jeunes entreprises,
  • Facilite la création de groupes de Business Angels dans les associations d'anciens élèves des Grandes Ecoles.

Ses adhérents, aux expériences professionnelles reconnues, ont participé en 2017 à 26 levées de fonds, apportant 3.1 M€ à des entreprises.
Depuis 2005, les Business Angels des Grandes Ecoles ainsi ont financé 150 entreprises en apportant plus de 25M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 75 M€ d'apport de Capitaux dans les entreprises

Les Business Angels des Grandes Ecoles
Tel : 01.42.22.67.35
secretariat@business-angels.info
www.business-angels.info

   
 partenaires
 

COMITÉ DE RÉDACTION : Henri Jannet, Président / Paul Leondaris Délégué Général
Adressez votre sujet à la rédaction: secretariat@business-angels.info

Se désabonner

 

Loguez vous pour ajouter un commentaire.


 
26
Déc
'18

Communiqué de presse OncoDiag®

 


 

Communiqué de presse OncoDiag®

OncoDiag

OncoDiag®  vient de boucler avec succès une seconde augmentation de capital, d’un montant de 600 k€. Les Business Angels des Grandes Ecoles (BAdGE) ont participé à ce tour à hauteur de 390 k€. Deux autres Associations de Business Angels, Angels Santé et Normandie Business Angels ont également co-investi dans cette levée de fonds.

OncoDiag® est une société spécialisée dans le développement de solutions innovantes pour le diagnostic précoce et la surveillance des cancers. Les premiers tests concernent le cancer de la vessie et le cancer colorectal.

Lauréat du Concours Mondial de l'Innovation, OncoDiag développe depuis plusieurs années un test urinaire permettant de diagnostiquer et de suivre des patients ayant un cancer de la vessie. Ce test, nommé Urodiag®, est désormais validé et dispose du marquage CE-IVD. L’augmentation de capital permettra de financer pour une partie la recherche de partenaires pour la commercialisation de ce test et pour une autre partie les travaux nécessaires à la validation, l’industrialisation et le marquage CE du test Colodiag®, test sanguin de diagnostic précoce du cancer colorectal pour lequel a déjà été réalisée une pré-validation clinique.

« Ces nouveaux tests ont un fort potentiel d’amélioration de la santé publique : en effet, des tests urinaires ou sanguins, pourront se substituer avec la même précision de diagnostic à des tests désagréables pour les patients (cystoscopie ou coloscopie), nécessitant une anesthésie et ils seront beaucoup moins coûteux pour la collectivité. Mieux acceptés par les patients qui souvent sont très réticents à faire des cystoscopies ou des coloscopies à la fréquence nécessaire, ils permettront un meilleur diagnostic précoce et un meilleur suivi après une première alerte, évitant des frais de traitement de cancers non détectés suffisamment tôt » a déclaré Jacques Tamisier, instructeur et accompagnateur de Badge dans cette aventure d’innovation.

« Nous sommes en contact avec des partenaires potentiels pour la commercialisation du test Urodiag en France et à l’international et dès début 2019 nous allons utiliser ce test en routine hospitalière avec de grands hôpitaux parisiens, ce qui permettra d’organiser la communication vers tous les urologues » a déclaré Claude Hennion Président d’Oncodiag.  
                                                                                                                               

 

Créée en 2004, l'association les Business Angels des Grandes Ecoles est un  des 1ers réseaux de Business Angels en France .

Son objectif est le soutien à la création et au développement d'entreprises innovantes à fort potentiel de croissance et leur financement. Pour cela, le réseau des Business Angels des Grandes Ecoles,

  • met en relation les entrepreneurs avec les Business Angels investisseurs,
  • a noué des relations avec les principaux incubateurs et accélerateurs ,notamment ceux  créés au sein des Grandes Ecoles,
  • apporte soutien méthodologique et formation aux Business Angels
  • organise l'accompagnement de ces jeunes entreprises,
  • facilite la création de groupes de Business Angels dans les associations d'anciens élèves des Grandes Ecoles.

Ses adhérents, aux expériences professionnelles reconnues, ont participé en 2017 à 26 levées de fonds, apportant 3.1 M€ à des entreprises .
Depuis 2005, les Business Angels des Grandes Ecoles ainsi ont financé 150 entreprises en apportant plus de 25M€ qui, par effet de levier sur d'autres sources de financement, ont généré plus de 75 M€ d'apport de Capitaux dans les entreprises

 

 

Les Business Angels des Grandes Ecoles 
Tel : 01.42.22.67.35 
secretariat@business-angels.info 
www.business-angels.info

 

Loguez vous pour ajouter un commentaire.


 
02
Oct
'18

Lettre d'informations externe Octobre 2018 - n°99

                    Lettre d'information externe Oct 2018 N°99


   
Nos événements

 SAVE THE DATE !

SEMAINE DES BUSINESS ANGELS
Présentation de start-ups
sélectionnées par la coordination inter-réseaux Ile de France

Nous nous fédérons avec les 5 réseaux les plus importants d'Ile de France (PBA, FBA, Val Angels, Angel Santé, AMBA et INSEAD BA) pour sélectionner 3 start-ups localisées dans la Région, souhaitant lever 500 K€ et co-instruite par au moins 2 réseaux.

Inscriptions : lien

Présentation de projets
 
BUSINESS ANGELS 16
Prochaine réunion publique de présentation de projets :

Le mardi 9 octobre 2018 à 17h30
 à La Maison des X
12 rue de Poitiers 75007 Paris
en salon Aigle
ou en streaming grâce à notre partenaire Bpifrance (Euroquity)

Prochaines dates à retenir:
Mardi 13 novembre à 17h30
Mardi 18 décembre à 17h30
PROCHAINES FORMATIONS
 
  • Formation "Les métiers du business angel"
    Le mercredi 10 octobre

    de 17h30 à 19h30
     
    Maison des X (salon Aigle)

    par Henri Jannet, Président des Business Angels des Grandes Ecoles
    Cette formation est ouverte à tous et en priorité aux nouveaux adhérents
    Pour s'inscrire : cliquez ici
  • Formation instruction
    Le mardi 6 novembre
    de 14h à 17h
    Maison des X (Salon Louis Armand)
    par Michel Huet, Vice-Président en charge de l'Instruction
    Pour s'incrire: cliquez ici
  • Formation Pacte d'actionnaires
    par Henri Jannet, Président
    - Jeudi 20 novembre de 15h à 17h: Structure du pacte d'actionnaire.
    Inscription: séance 1 Pacte
    - Jeudi 17 janvier de 15h à 17h:
    Clauses délicates du pacte d'actionnaire (1ère partie)
    Inscription: séance 2 Pacte
    - Mars 2018 (la date sera prochainement publiée sur la plateforme)
    Clauses délicates du pacte d'actionnaire (2ème partie)
    Inscription: séance 3 Pacte

 

 

INSCRIVEZ-VOUS !

UNIVERSITE D'AUTOMNE
FRANCE ANGELS

Lien-inscription

SUIVEZ-NOUS SUR LES RÉSEAUX SOCIAUX
 
Suivez-nous sur linkedin :
Les BAs des Grandes Ecoles

Suivez-nous sur twitter : @BAGrandesEcoles

ZOOM 
SUR NOS SOCIETES INVESTIES


HEMARINA 
DANS OUEST-FRANCE
ET 
LES ECHOS ENTREPRENEURS

DERNIERE MINUTE !

Hemarina vient d'être élue

START-UP DE L'ANNEE

Prix de l’Entrepreneur 
EY Ouest 

article- Les-Echos-Entrepreneurs

Pour lire l'article 
paru dans Ouest-France

 

 

 

PROJETS BOUCLES

107331 1422615792 innovation 660x352p

HEALSY

HEALSY REMPORTE DEUX NOUVEAUX PRIX PRESTIGIEUX POUR SON IA DE PREDICTION DE LA GLYCEMIE

Pour lire le communiqué de presse complet, cliquez ici

 

 
 
 
 
 
 

FLASH INFO IESF N°75
 
Découvrez le Flash info IESF n°75 : L'enquête IESF 2018 est ouverte, appel à candidatures IESF, sondage cyber-risques...
GRANDANGLE N° 92
 
La CGE et ses écoles membres se mobilisent pour l’apprentissage dans le supérieur.


 
Chers adhérents
Edito du Président

Les cinq métiers du Business Angel.

Ces cinq métiers s'exercent en alternant les démarches collectives avec l'appui du réseau de Business Angels et la décision individuelle.

  • Détecter les start up les plus prometteuses (les pépites) est la première étape. Plus de 1000 entreprises sont ainsi écoutées chaque année, principalement lors des nombreuses séances de présentation de projets organisées par les  incubateurs et accélérateurs.
  • Instruire les dossiers de levée de fonds après avoir écouté les porteurs de projets en comité de sélection par une compréhension approfondie du projet et de son business model, la négociation des conditions d'entrée au Capital (notamment la, valorisation) et la négociation du pacte d'actionnaires indispensable pour protéger les intérêts des minoritaires.
  • Investir est une décision individuelle prise après la présentation des projets par leurs promoteurs en réunion mensuelle et au vu du rapport des instructeurs.
  • Accompagner l'entreprise dans la durée est essentielle, c'est la fonction de l'accompagnateur qui consacre du temps au suivi de la société et en conseil en comité stratégique. Mettre en relation avec des partenaires ou des clients potentiels est un concours apprécié des entreprises.
  • Enfin, « last but not least », organiser la sortie des BA après 5 à 10 ans de soutien : la recherche d'acteurs susceptibles de prendre le relais des BA pour assurer le développement de l'entreprise, démarche longue et difficile, implique un investissement personnel important des BA les plus dynamiques et engagés.

Adhérer à un réseau de Business Angels  permet d'exercer ces cinq métiers dans les meilleures conditions et un programme de formation adapté est proposé à tous les adhérents des Business Angels des Grandes Ecoles 

 

 

Amicalement,
Henri Jannet
nos actualites

POSITION DE FRANCE ANGELS
CONCERNANT LA LOI PACTE

La Loi Pacte qui a animé une grande partie de cette année 2018 est actuellement en débat à l’Assemblée Nationale. Nous souhaitons vous faire un point concernant les propositions présentées et défendues par France Angels au cours de l’été ainsi que sur l’état actuel des débats sur ces dernières.

#PROPOSITIONS DE France ANGELS :

Les 7 documents joints contiennent :

  • Synthèse des 6 propositions détaillées
  • Projet d’amendement d’éligibilité des SEP (Sociétés En Participation) en structure fiscale interposée de la société en participation
  • Projet d’amendement d’éligibilité de la SEP au PEA-PME
  • Simplification des règles de la directive AIFM
  • Projet d’amendement pour un PEA-PME à gestion déclarative
  • Projet d’amendement d’éligibilité des OCA et ORA au PEA-PME
  • Projet d’amendement d’éligibilité des BSA et Actions de Préférence  au PEA-PME

#DEBATS A L’ASSEMBLEE NATIONALE :

Vous pourrez consulter le compte-rendu des derniers échanges de la Commission des Finances via le lien suivant : http://www.assemblee-nationale.fr/15/cr-cspacte/17-18/c1718014.asp

(Aller à la fin, après l’article 26…)

En résumé, voici les dernières informations reçues de la part du Député de la Haute-Savoie, Xavier Roseren, qui soutient nos propositions :

« Concernant vos propositions d’amendements sur l’élargissement des produits éligibles au PEA/PME, je vous informe que la commission a adopté un amendement visant à rendre éligible les obligations convertibles et les obligations remboursables en actions (amendement n°1903). Par ailleurs, un travail est actuellement mené par les services ministériels concernant l’amendement portant sur les SEP. Lors de l’examen de ce sujet en commission, le Ministre de l’Economie a fait valoir que ce travail était mené en collaboration avec le Trésor et le réseau Business Angels. Dès lors, n’hésitez pas à me tenir informée des suites.

Je tenais également à vous faire part d’autres avancées obtenues sur le PEA/PME à la suite de l’adoption de plusieurs amendements déposés par la majorité : fusion du plafond PEA et PEA/PME entrainant augmentation du plafond du PEA/PME à 225 000 euros, élargissement du PEA/PME aux sociétés non cotées, plafonnement des frais de tenue de compte et des délais de transfert pour les PEA et PEA/PME ou encore l’absence de clôture automatique lors d’un retrait avant 8 ans en cas de licenciement, mise à la retraite anticipée ou invalidité ».

N'hésitez pas à transmettre ces amendements auprès de vos Parlementaires.

Nous aurons l’occasion de partager sur ces points lors de la prochaine Université d’Automne de France Angels les 16 et 17 octobre à Dijon.

 RECRUTEMENT D'AUTOMNE :
FORMATION NOUVEAUX ARRIVANTS

Nous souhaitons atteindre 500 adhérents.
La formation et l'intégration des nouveaux arrivants est une priorité.
Nous avons sensibilisé nos 20 correspondants Ecole lors de la dernière réunion le 30 mai dernier et nous nous appuyons sur eux pour amener des business angels motivés à sélectionner, instruire et investir dans des start-ups.
N'hésitez pas à inviter une connaissance pour notre prochaine réunion et à lui faire part de notre offre découverte à 80€ valable jusqu'à la fin de l'année 2018. 

Lien pour nous soumettre une candidature pour la formation nouveaux arrivants

MOBILISATION POUR
LE DENICHAGE DE NOUVELLES PEPITES: 
L'EVENEMENT Bpifrance
BIG

Vous arrivez dans l'association?
Vous êtes en activité et n'avez que quelques heures par mois à consacrer à BAdGE?
N'hésitez pas à vous inscrire à l'événement Bpifrance du 11 octobre pour rejoindre l'équipe des adhérents chargés du suivi des incubateurs et pépinières animé par Paul Bruma.

Pour obtenir votre badge d'entrée: badge-BIG 
Pour communiquer vos horaires de disponibilité : horaires-disponibilités

COMPTE-RENDU
DE L'EVENEMENT SINAAPS,
PLATEFORME
DE CO-INVESTISSEMENT DE SCIENTIPOLE CAPITAL


Nous remercions chaleureusement Scientipole Capital pour la coopération initiée avec BAdGE dès le lancement de la plateforme Siinaps dont nous sommes partenaires.
Cette plateforme dédiée aux entreprises du plateau de Saclay souhaite donner une place privilégiée aux  réseaux de Business Angels tout en permettant à de nouveaux investisseurs de se familiariser avec l'apport de financement en start-ups.

Sur les 3 projets présentés lors de ce lancement, deux projets ont été déposés sur la plateforme BAdGE:

  • Phonoptics (7 intentions d'investissement à ce jour sur siinaps)

Une délégation d'une dizaine d'investisseurs de notre association s'est rendue sur place pour ce lancement de la plateforme Siinaps.

Lors de la soirée a été annoncé une prochaine coopération entre Siinaps et BAdGE concernant le projet Eikosim.


SOCIETES EN FIN DE PROCESSUS D'INSTRUCTION

 
107331 1422615792 innovation 660x352p
 

START-UPS EN PHASE 3 D'INSTRUCTION 
(CLOSING)

 
START-UP 1 : développe un système de mesure à distance par voie optique permettant toute sorte de mesure dans les environnements les plus hostiles (risques d’explosions, température, rayonnement, etc …). 

Pour en savoir plus :lien Start-up 1
Montant recherché: 250 K€
Date de clôture: Octobre

 

START-UPS EN PHASE 2 D'INSTRUCTION 
(NEGOCIATION FINALE)

START-UP 2:Technologie de communication sans fil par ultrason breveté Stimcom pour les milieux contraints industriels ultra sécurisés, électrosensibles ou en atmosphère explosive.

Pour en savoir plus :
lien-Start-up 2
Montants recherchés:700 K€ (dont 200 K€ pour BAdGE)
Date de clôture:
fin d'année 2018


START-UP 3
:Développement de kits rapides et utilisables sur site afin de détecter les parasites/maladies des plantes, les résistances aux pesticides, la présence d'OGM, par la technique PCR (Polymerase Chain Reaction) qui duplique rapidement les séquences d'ADN.
 
Pour en savoir plus:lien Start-up 3
Montants recherchés: 500 K€
Date de clôture: fin d'année 2018
 
 
START UP 4 : La présentation de cette application de paiement mobile Android, en marque blanche, à destination des banques a rencontré un franc succès lors de l'événement avec l'un de nos partenaires. . 

Fintech B2B vendant des cartes bancaires numérisées, en marque blanche, Antelop s'adresse à BAdGE pour sa deuxième levée. 

Pour en savoir plus lien Start-up 4
Montant recherché: 750 K€ (dont 150 K€ chez BAdGE)
Date de clôture: octobre

STAT-UP N°5 : tests diagnostiques prêts à l'emploi par les vétérinaires pour détecter les maladies infectieuses chez les animaux de compagnie. 
Les premiers tests vétérinaires ont été commercialisés en avril 2018 en France. La start-up cherche désormais des fonds complémentaires pour accélérer la commercialisation en France, partir à l'export sur l'Europe et les Etats-Unis, étendre ses brevets à l'international.

Pour en savoir plus : lien Start-up n°5
Montant recherché: 500 K€ dans le cadre de la plateforme de co-financement Sinaaps, en partenariat avec Scientipole
Date de clôture: fin 2018

 
 
   
 partenaires
 

COMITÉ DE RÉDACTION : Henri Jannet, Président / Marie-Pierre Bonnet, Déléguée générale
Adressez votre sujet à la rédaction: marie-pierre.bonnet@business-angels.info

Se désabonner

Loguez vous pour ajouter un commentaire.


 
03
Oct
'16

Les Business Angels des Grandes Ecoles participent à la levée de fonds de 500K€ de RogerVoice, l'application qui permet aux sourds et malentendants de téléphoner

Communiqué de Presse

 
 

La jeune société RogerVoice lève 500K€ dont 100K€ auprès des Business Angels des Grandes Ecoles



Paris, le 03/10/2016

RogerVoice, l’application qui permet aux sourds et malentendants de téléphoner, vient de lever 500 K€ avec la participation des Business Angels des Grandes Ecoles pour 100K€ afin de poursuivre son développement en France et à l’international en recrutant de nouveaux collaborateurs.

Créée en 2014 suite à une campagne Kickstarter au cours de laquelle elle rassemblait 35 000 dollars de financement, l’application RogerVoice a véritablement vu le jour en 2015. Son objectif : Rendre enfin accessible le téléphone aux malentendants, en retranscrivant en direct une conversation orale en un texte. Les utilisateurs peuvent ensuite y répondre à l’oral ou à l’écrit, le texte  étant instantanément transformé en voix pour la personne au bout du fil.

La startup vient aujourd’hui de boucler une levée de fonds de 500 000 euros. Un tour de table porté par des clubs de business angels, notamment Les Business Angels des Grandes Ecoles, Femmes Business Angels, et Sophia Business Angels, mais également piloté par la plateforme de crowdfunding 1001pact.com en partenariat avec le fonds du Comptoir de l’Innovation et AVIVA Impact Investing, permettant d’ajouter 1 euro à l’investissement, pour chaque euro investi. 

Une enveloppe qui permettra à RogerVoice de recruter de nouveaux collaborateurs, dont les compétences devraient accompagner la jeune pousse dans son développement. Une accélération d’activité qui passera également par la mise en place de plusieurs partenariats avec des entreprises souhaitant rendre leurs services clients accessibles aux malentendants. C’est par exemple le cas d’Orange, mais également AUDIO2000, via ses sites web et SNCF Développement avec Voyages-sncf.com.

L’application, disponible à ce jour dans près de 20 langues, est enfin entrée en relation avec des opérateurs étrangers pour une distribution étendue. Celle qui revendique déjà plus de 10 000 téléchargements pourrait alors atteindre un marché mondial de 70 millions de sourds profonds.  

« Ce projet est pour nous doublement intéressant : par son potentiel économique, à un moment où la réglementation va demander aux opérateurs de télécommunication d’avoir une offre pour les sourds et malentendants, et par sa forte utilité sociale. Il a d’ailleurs été pour nous l’occasion de faire connaissance avec de nouveaux acteurs dans ce domaine, et d’établir une collaboration prometteuse » nous précise Etienne Jacquemin, instructeur et accompagnateur du projet pour les Business Angels des Grandes Ecoles.
 
“Nous pouvons ainsi étoffer l’équipe avec les compétences nécessaires à notre développement,” se réjouit le fondateur franco-américain Olivier Jeannel, lui-même sourd-profond. “La réussite de cette campagne, effectuée en temps record, souligne la dynamique de l’écosystème d’investissement participatif en France.”

A propos des Business Angels des Grandes Ecoles



L'association "les Business Angels des Grandes Écoles", un  des 1ers réseaux de Business Angels en France, soutient le développement d'entreprises innovantes à fort potentiel de croissance et leur financement.

Pour cela, le réseau des Business Angels des Grandes Écoles :

- analyse plus de 350 dossiers déposés sur sa plateforme chaque année
- met en relation les entrepreneurs avec les Business Angels investisseurs,
- apporte soutien méthodologique et formation aux Business Angels,
- organise l'accompagnement de ces jeunes entreprises,
- facilite la création de groupes de Business Angels dans les associations d'anciens élèves des Grandes Écoles.

Ses 265 adhérents, aux expériences professionnelles reconnues, financent et accompagnent une vingtaine de sociétés chaque année.

Depuis sa création en 2005, les Business Angels des Grandes Écoles ont financé 140 entreprises, en apportant 20 M€ de capitaux avec un important effet de levier sur d'autres sources de financement dans les entreprises.

Pour en savoir plus : www.business-angels.info

Linkedin : cliquez ici
Twitter : @BAGrandesEcoles

Pour nous contacter :
candice@business-angels.info  
12 rue de Poitiers – 75007 Paris
01 42 22 67 35

A propos de RogerVoice



RogerVoice, le téléphone qui écrit, permet aux sourds et malentendants de téléphoner. Cette application, disponible sur le Play Store et l’App Store, utilise la reconnaissance vocale pour transcrire la parole en texte, et inversement avec la synthèse vocale, automatiquement et en temps réel.

RogerVoice SAS est une startup basée à Paris dont l’activité s’étend à l’international. Rien qu’en France, plus de 500 000 sourds profonds ne peuvent téléphoner ; ce chiffre dépasse 7 millions au niveau mondial,  sans compter la population des seniors.
 
Contact presse :
Olivier Jeannel
+33 6 30 13 08 80  (SMS)  olivier@rogervoice.com
Kit Presse disponible sur Google Drive
Site internet : https://rogervoice.com/fr/


 

Pour vous désinscrire : cliquez ici

Loguez vous pour ajouter un commentaire.


 
06
Juil
'16

Themecloud lève 520 K€ dont 207 K€ auprès des Business Angels des Grandes Ecoles

Pour lire cet email en ligne : cliquez ici

Communiqué de Presse

 
 

Les Business Angels des Grandes Ecoles participent à la levée de fonds de 520 K€ de Themecloud, une plateforme d'hébergement WordPress de nouvelle génération



Paris, le 04/07/2016

Themecloud, startup française spécialisée dans la création et l'hébergement de sites web sous Wordpress, vient de lever 520 K€ dont 207 K€ auprès des Business Angels des Grandes Ecoles (BADGE), avec la participation d'Investessor, de Davidson Consulting et de Bpifrance pour accélérer sa croissance et se développer à l'international.

Themecloud a mis au point une solution logicielle, basée sur Docker™, qui facilite la création, l’hébergement et la gestion de sites WordPress™. Cette solution tout-en-un répond à un réel besoin : en effet, plus d’un site sur quatre repose aujourd’hui sur la technologie WordPress. Ce standard pour les professionnels n’est toutefois pas toujours accessible aux entreprises ne pouvant passer par une agence web. Aussi, Themecloud propose un processus simplifié ne nécessitant pas de compétences techniques. La solution de la startup permet notamment à son utilisateur d’obtenir l’hébergement de son site Web, un nom de domaine, de bénéficier des conseils d’experts disponibles par chat 24/7 en 2 langues ainsi que d’un service de sauvegarde automatique. Le tarif débute à 9 euros par mois pour un site dimensionné pour 10.000 visites mensuelles, 5Go de stockage et des sauvegardes quotidiennes.
 
"Avec Themecloud, nous souhaitons démocratiser WordPress, rendre cet outil incroyable, accessible à n'importe qui, quel que soit son budget ou ses compétences techniques" confie Laurent Vergnaud, co-fondateur.

"L’équipe de Themecloud, grâce à son dynamisme, son sens de l’écoute et sa grande compétence technique est parfaitement armée pour offrir à ses clients un service très ergonomique et efficace"  souligne François Levieux, accompagnateur du projet pour les Business Angels des Grandes Ecoles
 

A propos des Business Angels des Grandes Ecoles



L'association "les Business Angels des Grandes Écoles", un  des 1ers réseaux de Business Angels en France, soutient le développement d'entreprises innovantes à fort potentiel de croissance et leur financement.

Pour cela, le réseau des Business Angels des Grandes Écoles :

- analyse plus de 350 dossiers déposés sur sa plateforme chaque année
- met en relation les entrepreneurs avec les Business Angels investisseurs,
- apporte soutien méthodologique et formation aux Business Angels,
- organise l'accompagnement de ces jeunes entreprises,
- facilite la création de groupes de Business Angels dans les associations d'anciens élèves des Grandes Écoles.

Ses 265 adhérents, aux expériences professionnelles reconnues, financent et accompagnent une vingtaine de sociétés chaque année.

Depuis sa création en 2005, les Business Angels des Grandes Écoles ont financé 140 entreprises, en apportant 20 M€ de capitaux avec un important effet de levier sur d'autres sources de financement dans les entreprises.

Pour en savoir plus : www.business-angels.info

Linkedin : cliquez ici
Twitter : @BAGrandesEcoles

Pour nous contacter :
candice@business-angels.info  
12 rue de Poitiers – 75007 Paris
01 42 22 67 35
 

A propos de Themecloud



Themecloud est une startup française crée en juin 2014 qui a pour ambition de démocratiser l’accès aux outils web et d’en faciliter la distribution. Sa solution ? Automatiser les tâches liées au déploiement, à l’hébergement, à la sécurité et aux mises à jour, le tout grâce à Docker, la technologie cloud de nouvelle génération promue par Google, Amazon, Microsoft et bien d’autres.
 
Pour en savoir plus : https://www.themecloud.io/

Contact :
Laurent Vergnaud, co-fondateur de Themecloud

 
Pour vous désinscrire : cliquez ici
 

Loguez vous pour ajouter un commentaire.